Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00762

Target Information
Name3-dehydroquinate synthase    
Type of targetResearch target    
SynonymsAROB    
Dehydroquinate synthase    
DiseaseBacterial infections
[ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104   ICD10: A00-A09, A15-A19, A20-A28, A30-A49, A65-A69, A70-A74, A75-A79]
[1]
Fungal diseases
[ICD9: 110-118   ICD10: B35-B49]
[2][1]
BioChemical ClassCarbon-oxygen lyases    
EC NumberEC 4.2.3.4
PathwayMetabolic pathways
Phenylalanine, tyrosine and tryptophan biosynthesis
UniProt IDP07639
SequenceMERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQA GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA GLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIADCQ SA
InhibitorCarbaphosphonate[3]
Nicotinamide-Adenine-Dinucleotide[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Structure of dehydroquinate synthase reveals an active site capable of multistep catalysis. Nature. 1998 Jul 16;394(6690):299-302. To Reference
Ref 2Identification of many crystal forms of Aspergillus nidulans dehydroquinate synthase. Acta Crystallogr D Biol Crystallogr. 2001 Feb;57(Pt 2):306-9. To Reference
Ref 3Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543