Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00771

Target Information
NameGlycine receptor alpha-1 chain    
Type of targetResearch target    
SynonymsGlycine receptor 48 kDa subunit    
Strychnine binding subunit    
Strychnine-insensitive glycine receptor    
DiseaseConvulsions
[ICD9: 780.3   ICD10: R56.0]
[1]
Depression
[ICD9: 311   ICD10: F32]
[1]
BioChemical ClassChloride channel    
PathwayNeuroactive ligand-receptor interaction
UniProt IDP23415
PDB Structure1MOT; 1VRY.    
FunctionThe glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing).    
SequenceMYSFNTLRLYLWETIVFFSLAASKEAEAARSAPKPMSPSDFLDKLMGRTSGYDARIRPNF KGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPDDSLDLDPSMLDS IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTC IMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEA RFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRA SLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKSPMLNLF QEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRA KKIDKISRIGFPMAFLIFNMFYWIIYKIVRREDVHNQ
Target ValidationClick to Find Target Validation Information.    
Inhibitor10-methoxy-ginkgolide C[2]
3,14-DIDEHYDROGINKGOLIDE A[2]
3-demethoxy-3-D-lyxopyranosylaminothiocolchicine[3]
3-demethoxy-3-D-mannopyranosylaminothiocolchicine[3]
3-demethoxy-3-D-xylopyranosylaminothiocolchicine[3]
3-demethoxy-3-L-fucopyranosylaminothiocolchicine[3]
3-demethoxy-3D-glucopyranosylaminothiocolchicine[3]
D-Serine[4]
GINKGOLIDE A[2]
GINKOLIDE B[2]
STRYCHNINE[3]
THIOCOLCHICOSIDE[3]
ginkgolide C[2]
ginkgolide J[2]
ginkgolide M[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Effects of strychnine-insensitive glycine receptor ligands in rats discriminating dizocilpine or phencyclidine from saline. J Pharmacol Exp Ther. 1997 Jan;280(1):46-52. To Reference
Ref 2J Med Chem. 2007 Apr 5;50(7):1610-7. Epub 2007 Mar 13.Probing the pharmacophore of ginkgolides as glycine receptor antagonists. To Reference
Ref 3J Med Chem. 2006 Sep 7;49(18):5571-7.3-demethoxy-3-glycosylaminothiocolchicines: Synthesis of a new class of putative muscle relaxant compounds. To Reference
Ref 4Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543