Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00806

Target Information
NamePresynaptic density protein 95    
Type of targetResearch target    
SynonymsDiscs, large homolog 4    
PSD-95    
Postsynaptic density-95    
DiseaseAnalgesics
[ICD9: 338   ICD10: R52]
[1]
Chronic neuropathic pain
[ICD9: 338,780   ICD10: R52, G89]
[1]
Opioid dependence
[ICD9: 304.0   ICD10: F11.2]
[2]
BioChemical ClassCell membrane protein    
UniProt IDP78352
PDB Structure1KEF; 3I4W; 3K82; 3ZRT.    
FunctionInteracts with the cytoplasmic tail of nmda receptor subunits. May be involved in synaptogenesis.    
SequenceMDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGE MEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFV NEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGN QHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVY LKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKD LLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQIL SVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDS ETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIIL GPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIE AGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLE INKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPA RERL
Target ValidationClick to Find Target Validation Information.    
Inhibitor2-Methyl-2,4-Pentanediol[3]
FETAV[4]
Guanosine-5'-Monophosphate[3]
KSG-LDTKNYKQTSV[4]
KSG-YEKLSSIESDV[4]
N- (3,4-Dichlorophenyl)propyl-ETAV[4]
N- (3,4-Difluorophenyl)propyl-ETAV[4]
N- (Naphthalene-2-yl)ethyl-ETAV[4]
N-Benzyl-ETAV[4]
N-Butyl-ETAV[4]
N-Cyclohexylethyl-ETAV[4]
N-Cyclohexylmethyl-ETAV[4]
N-Ethyl-ETAV[4]
N-Methyl-ETAV[4]
N-Phenylethyl-ETAV[4]
N-Phenylpropyl-ETAV[4]
N-Propyl-ETAV[4]
YGRKKRRQRRR-KLSSIESDV[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Role of postsynaptic density protein-95 in the maintenance of peripheral nerve injury-induced neuropathic pain in rats. Neuroscience. 2003;117(3):731-9. To Reference
Ref 2Knockdown of spinal cord postsynaptic density protein-95 prevents the development of morphine tolerance in rats. Neuroscience. 2004;123(1):11-5. To Reference
Ref 3Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 4J Med Chem. 2008 Oct 23;51(20):6450-9. Epub 2008 Sep 24.Modified peptides as potent inhibitors of the postsynaptic density-95/N-methyl-D-aspartate receptor interaction. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543