Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00843

Target Information
NameElongation factor 2    
Type of targetResearch target    
SynonymsEF2    
DiseaseFungal diseases
[ICD9: 110-118   ICD10: B35-B49]
[1]
EC NumberEC 3.6.5.3
UniProt IDO13430
P13639
PDB Structure3J3A.    
FunctionThis protein promotes the gtp-dependent translocation of the nascent protein chain from the a-site to the p-site of the ribosome.    
SequenceMVAFTIEQIRGLMDKVTNVRNMSVIAHVDHGKSTLSDSLVQKAGIISAAKAGDARFMDTR KDEQERGITIKSTAISLYASMTDEDVKDIKQKTDGNSFLVNLIDSPGHVDFSSEVTAALR VTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVVINKVDRALLELQTTKEDLYQTFAR TVESVNVIISTYCDPVLGDVQVYPQKGTVAFASGLHGWAFTVRQFANKYSKKFGVDKEKM MERLWGDSYFNPKTKKWTNKDKDADGKPLERAFNMFILDPIFRLFAAIMNFKKDEIPVLL EKLEIQLKGDEKDLEGKALLKVVMRKFLPAADALLEMIVLHLPSPVTAQAYRAETLYEGP SDDPFCTAIRNCDPNADLMLYVSKMVPTSDKGRFYAFGRVFAGTVKSGQKVRIQGPNYQV GKKEDLFLKSIQRTVLMMGRSVEQIDDCPAGNIIGLVGIDQFLLKSGTITTNEAAHNMKV MKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEI CLQDLENDHAGVPLRISPPVVSYRETVEGESSMVALSKSPNKHNRIYVKAQPIDEEVSLD IENGVINPRDDFKARARILADKHGWDVVDARKIWCFGPDGNGPNLVVDQTKAVQYLNEIK DSVVAAFQWATKEGPIFGENCRSVRVNILDVTLHADAIHRGGGQIIPTMRRVTYASMLLA EPAIQEPVFLVEIQCPENAIGGIYSVLNKKRGQVISEEQRPGTPLFTVKAYLPVNESFGF TGELRQATGGQAFPQLIFDHWQVMSGDVTDENSKPGAIVKEKRVRAGLKPEVPEYTEYYD KL
InhibitorAdenosine-5-Diphosphoribose[2]
Diphthamide[3]
Guanosine-5'-Diphosphate[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Elongation factor 2 as a novel target for selective inhibition of fungal protein synthesis. J Biol Chem. 1998 Feb 6;273(6):3148-51. To Reference
Ref 2Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 3Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543