Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00848

Target Information
NameDeoxyhypusine synthase    
Type of targetResearch target    
SynonymsDHS    
DiseaseCancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[1]
BioChemical ClassTransferases transferring alkyl or aryl groups    
EC NumberEC 2.5.1.46
UniProt IDP49366
PDB Structure1DHS; 1RLZ; 1ROZ; 1RQD.    
FunctionCatalyzes the nad-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eif-5a precursor protein to form the intermediate deoxyhypusine.    
SequenceMEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFG RAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLV QHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFE DWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGS LGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMRNGA DYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKMD AFMHEKNED
Target ValidationClick to Find Target Validation Information.    
Inhibitor1-Guanidinium-7-Aminoheptane[2]
GC7[1]
N-guanyl-1,7-diaminoheptane[3]
N1-guanyl-1,7-diaminoheptane[1]
Nicotinamide-Adenine-Dinucleotide[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Effects of N1-guanyl-1,7-diaminoheptane, an inhibitor of deoxyhypusine synthase, on the growth of tumorigenic cell lines in culture. Biochim Biophys Acta. 1996 Jan 10;1310(1):119-26. To Reference
Ref 2Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 3Bioorg Med Chem. 2007 Sep 15;15(18):6200-7. Epub 2007 Jun 14.Modification of eukaryotic initiation factor 5A from Plasmodium vivax by a truncated deoxyhypusine synthase from Plasmodium falciparum: An enzyme with dual enzymatic properties. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543