Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00862

Target Information
NameAspartate-semialdehyde dehydrogenase    
Type of targetResearch target    
SynonymsASA dehydrogenase    
ASADH    
L-Aspartate-beta-semialdehyde dehydrogenase    
DiseaseBacterial infections
[ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104   ICD10: A00-A09, A15-A19, A20-A28, A30-A49, A65-A69, A70-A74, A75-A79]
[1]
Fungal diseases
[ICD9: 110-118   ICD10: B35-B49]
[1]
BioChemical ClassOxidoreductases acting on the aldehyde or oxo group of donors    
EC NumberEC 1.2.1.11
PathwayGlycine, serine and threonine metabolism
Lysine biosynthesis
Metabolic pathways
UniProt IDP00353
P23247
PDB Structure2QZ9; 2R00.    
SequenceMKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDL EALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVIT DGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMG HLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR EEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNP WAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLR RMLRQLA
Target ValidationClick to Find Target Validation Information.    
Inhibitor2'-Monophosphoadenosine 5'-Diphosphoribose[2]
Aspartate Semialdehyde[2]
Cacodylate Ion[2]
S-sulpho-L-cysteine[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1A structural basis for the mechanism of aspartate-beta-semialdehyde dehydrogenase from Vibrio cholerae. Protein Sci. 2003 Jan;12(1):27-33. To Reference
Ref 2Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 3J Nat Prod. 2005 May;68(5):804-6.Petrosamine B, an inhibitor of the Helicobacter pylori enzyme aspartyl semialdehyde dehydrogenase from the Australian sponge Oceanapia sp. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543