Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00895

Target Information
NameNH(3)-dependent NAD(+) synthetase    
Type of targetResearch target    
SynonymsDiphosphopyridine nucleotide synthetase    
NAD synthase    
NAD synthetase    
NAD(+)-synthetase    
NAD+ synthase    
NAD+ synthetase    
NadE    
Nicotinamide adenine dinucleotide synthetase    
Nitrogen-regulatory protein    
DiseaseBacillus subtilis infections
[ICD9: 001-139   ICD10: A00-B99]
[1]
Bacterial infections
[ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104   ICD10: A00-A09, A15-A19, A20-A28, A30-A49, A65-A69, A70-A74, A75-A79]
[2][3]
BioChemical ClassLigases forming carbon-nitrogen bonds    
EC NumberEC 6.3.1.5
EC 6.3.5.1
PathwayMetabolic pathways
Nicotinate and nicotinamide metabolism
Nitrogen metabolism
UniProt IDP18843
PDB Structure1WXE; 1WXF; 1WXG; 1WXH; 1WXI.    
FunctionThis nad synthase uses nh(3) in preference to glutamine.    
SequenceMTLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLC QMAINELRLETGNESLQFIAVRLPYGVQADEQDCQDAIAFIQPDRVLTVNIKGAVLASEQ ALREAGIELSDFVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTD INPLYRLNKRQGKQLLAALACPEHLYKKAPTADLEDDRPSLPDEVALGVTYDNIDDYLEG KNVPQQVARTIENWYLKTEHKRRPPITVFDDFWKK
Related US Patent6,500,852
6,673,827
InhibitorAlpha,Beta-Methyleneadenosine-5'-Triphosphate[4]
Deamido-Nad+[4]
Diphosphate[4]
Nicotinamide-Adenine-Dinucleotide[4]
Pyrophosphate 2-[5]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Crystallization of NAD+ synthetase from Bacillus subtilis. Proteins. 1996 Oct;26(2):236-8. To Reference
Ref 2Tethered dimers as NAD synthetase inhibitors with antibacterial activity. J Med Chem. 2003 Jul 17;46(15):3371-81. To Reference
Ref 3Heterologous expression, purification, and enzymatic activity of Mycobacterium tuberculosis NAD(+) synthetase. Protein Expr Purif. 2002 Aug;25(3):547-57. To Reference
Ref 4Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 5Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543