Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00903

Target Information
NamePotassium voltage-gated channel subfamily A member 3    
Type of targetResearch target    
SynonymsHGK5    
HLK3    
HPCN3    
HuKIII    
Potassium channel Kv1.3    
Voltage-gated K(+) channel Kv1.3    
Voltage-gated Kv1.3 K(+) channel    
Voltage-gated potassium channel subunit Kv1.3    
DiseaseAutoimmune diseases
[ICD9: 279.4   ICD10: D84.9, M35.9]
[1]
Immunosuppression[1]
Multiple Sclerosis
[ICD9: 340   ICD10: G35]
[2][3]
T cell-mediated autoimmune diseases
[ICD9: 279.4   ICD10: D84.9, M35.9]
[3][2]
BioChemical ClassVoltage-gated channel    
UniProt IDP22001
FunctionMediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ion.    
SequenceMDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Target ValidationClick to Find Target Validation Information.    
Inhibitor1-Benzyl-7-chloro-4-hexyloxy-quinolinium,   bromide[4]
2-Methoxy-N- (3-methyl-2-phenyl-butyl)-benzamide[5]
4- (4-phenoxybutoxy)-7H-furo[3,2-g]chromen-7-one[6]
5- (4-Phenylbutoxy)psoralen[7]
CP-339818[8]
Correloid[9]
Correloid derivative[9]
Correloid derivative[9]
UK-78282[8]
[1-Benzyl-1H-quinolin- (4E)-ylidene]-hexyl-amine[4]
BlockerPsora-4[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Kv1.3-blocking 5-phenylalkoxypsoralens: a new class of immunomodulators. Mol Pharmacol. 2004 Jun;65(6):1364-74. To Reference
Ref 2Khellinone derivatives as blockers of the voltage-gated potassium channel Kv1.3: synthesis and immunosuppressive activity. J Med Chem. 2004 Apr 22;47(9):2326-36. To Reference
Ref 3The voltage-gated Kv1.3 K(+) channel in effector memory T cells as new target for MS. J Clin Invest. 2003 Jun;111(11):1703-13. To Reference
Ref 4J Med Chem. 1995 May 26;38(11):1877-83.Novel inhibitors of potassium ion channels on human T lymphocytes. To Reference
Ref 5Bioorg Med Chem Lett. 2003 Mar 24;13(6):1161-4.Benzamide derivatives as blockers of Kv1.3 ion channel. To Reference
Ref 6Bioorg Med Chem Lett. 2010 Dec 1;20(23):6989-92. Epub 2010 Oct 23.Substituted N-{3-[(1,1-dioxido-1,2-benzothiazol-3-yl)(phenyl)amino]propyl}benzamide analogs as potent Kv1.3 ion channel blockers. Part 2. To Reference
Ref 7Bioorg Med Chem Lett. 2010 Dec 1;20(23):6983-8. Epub 2010 Oct 7.N-{3-[(1,1-dioxido-1,2-benzothiazol-3-yl)(phenyl)amino]propyl}benzamide analogs as potent Kv1.3 inhibitors. Part 1. To Reference
Ref 8J Med Chem. 2001 Apr 12;44(8):1249-56.Angular methoxy-substituted furo- and pyranoquinolinones as blockers of the voltage-gated potassium channel Kv1.3. To Reference
Ref 9Bioorg Med Chem Lett. 2005 Jan 17;15(2):447-51.Potent Kv1.3 inhibitors from correolide-modification of the C18 position. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543