Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00927

Target Information
NameLymphocyte antigen 96    
Type of targetResearch target    
SynonymsESOP-1    
MD-2    
MD-2 protein    
DiseaseEndotoxin-mediated diseases[1]
PathwayPathogenic Escherichia coli infection
Pathogenic Escherichia coli infection
Toll-like receptor signaling pathway
UniProt IDQ9Y6Y9
PDB Structure1T2Z; 2E56; 2E59; 2Z65; 3FXI; 3ULA; 4G8A.    
FunctionCooperates with tlr4 in the innate immune response to bacterial lipopolysaccharide (lps), and with tlr2 in the response to cell wall components from gram-positive and gram-negative bacteria. Enhances tlr4-dependent activation of nf-kappa-b.    
SequenceMLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGL LHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFS FKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Inhibitor3-Hydroxy-Myristic Acid[2]
Lauric Acid[2]
MYRISTIC ACID[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Lysines 128 and 132 enable lipopolysaccharide binding to MD-2, leading to Toll-like receptor-4 aggregation and signal transduction. J Biol Chem. 2003 Nov 28;278(48):48313-20. Epub 2003 Sep 5. To Reference
Ref 2Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 3Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543