Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00957

Target Information
NameAdenosylhomocysteinase    
Type of targetResearch target    
SynonymsAdoHcyase    
S-adenosyl-L-homocysteine hydrolase    
SAH hydrolase    
DiseaseViral infection, unspecified
[ICD9: 001-139, 042-075   ICD10: A00-B99, A80-A99, B00-B34]
[1]
BioChemical ClassHydrolases acting on ether bonds    
EC NumberEC 3.3.1.1
PathwayMetabolic pathways
Methionine metabolism
Selenoamino acid metabolism
UniProt IDP23526
PDB Structure1A7A; 1LI4; 3NJ4.    
FunctionAdenosylhomocysteine is a competitive inhibitor of s-adenosyl-l-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration.    
SequenceMSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS CDGPFKPDHYRY
Target ValidationClick to Find Target Validation Information.    
Inhibitor3'-Oxo-Adenosine[2]
4 (Z)-[3]
5'-S-ethyl-5'-thioadenosine[4]
5'-deoxy-5'-ureidoadenosine[5]
5 (E)-[3]
5-methylenearisteromycin[6]
ARISTEROMYCIN[6]
D-Eritadenine[7]
ERITADENINE[8]
FLUORO-NEPLANOCIN A[9]
Isopropyl Alcohol[4]
NORARISTEROMYCIN[10]
Neplanocin A[11]
Nicotinamide-Adenine-Dinucleotide[7]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. To Reference
Ref 2Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference
Ref 3Bioorg Med Chem. 2008 May 15;16(10):5424-33. Epub 2008 Apr 12.Synthesis of 5'-functionalized nucleosides: S-Adenosylhomocysteine analogues with the carbon-5' and sulfur atoms replaced by a vinyl or halovinyl unit. To Reference
Ref 4Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 5Bioorg Med Chem Lett. 2007 Aug 15;17(16):4456-9. Epub 2007 Jun 8.Design, synthesis, and molecular modeling studies of 5'-deoxy-5'-ureidoadenosine: 5'-ureido group as multiple hydrogen bonding donor in the active site of S-adenosylhomocysteine hydrolase. To Reference
Ref 6Bioorg Med Chem. 2008 Apr 1;16(7):3809-15. Epub 2008 Jan 30.Synthesis of 2-modified aristeromycins and their analogs as potent inhibitors against Plasmodium falciparum S-adenosyl-L-homocysteine hydrolase. To Reference
Ref 7Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 8Bioorg Med Chem. 2009 Sep 15;17(18):6707-14. Epub 2009 Jul 28.A new structural class of S-adenosylhomocysteine hydrolase inhibitors. To Reference
Ref 9Bioorg Med Chem Lett. 2004 Nov 15;14(22):5641-4.Synthesis of 5'-substituted fluoro-neplanocin A analogues: importance of a hydrogen bonding donor at 5'-position for the inhibitory activity of S-adenosylhomocysteine hydrolase. To Reference
Ref 10Bioorg Med Chem Lett. 2008 Apr 15;18(8):2615-8. Epub 2008 Mar 14.Synthesis of 4'-modified noraristeromycins to clarify the effect of the 4'-hydroxyl groups for inhibitory activity against S-adenosyl-L-homocysteine hydrolase. To Reference
Ref 11Molecular approaches for the treatment of hemorrhagic fever virus infections. Antiviral Res. 1993 Sep;22(1):45-75. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543