Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00977

Target Information
NameCAMP-dependent protein kinase type I-alpha regulatory chain    
Type of targetResearch target    
SynonymsCAMP-dependent protein kinase (PKA)    
PKA RIalpha-subunit    
RIalpha subunit of cAMP-dependent protein kinase    
TSE1    
Tissue-specific extinguisher-1    
DiseaseCancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[1]
EC NumberEC 2.7.1.37
PathwayApoptosis
Insulin signaling pathway
UniProt IDP10644
SequenceMESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG PCSDILKRNIQQYNSFVSLSV
Target ValidationClick to Find Target Validation Information.    
Inhibitor5- (2-methylpiperazin-1-ylsulfonyl)isoquinoline[2]
AdcAhxArg4Lys (biotin)-PEG-OMe[3]
AdcAhxArg4Lys-PEGOMe[3]
AdcAhxArg4NH (CH2)6NH2[3]
AdcAhxArg6[3]
AdoC (Ahx)Arg6[4]
AdoC (Aoc)Arg6[4]
AdoC (Aun)Arg6[4]
AdoC (Dpr)2AlaArg6[4]
AdoC (GABA)Arg6[4]
AdoC (beta-Ala)2AlaArg6[4]
AdoC (beta-Ala)Arg6[4]
AdoC (betaAsp)2AlaArg6[4]
AdoCGlyArg6[4]
Cyclic Adenosine Monophosphate[5]
Cyclic Guanosine Monophosphate[5]
RO-316233[6]
Sp-Adenosine-3',5'-Cyclic-Monophosphorothioate[5]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Antisense oligonucleotide targeted to RIalpha subunit of cAMP-dependent protein kinase (GEM231) enhances therapeutic effectiveness of cancer chemotherapeutic agent irinotecan in nude mice bearing human cancer xenografts: in vivo synergistic activity, pharmacokinetics and host toxicity. Int J Oncol. 2002 Jul;21(1):73-80. To Reference
Ref 2J Biol Chem. 1996 Oct 18;271(42):26157-64.Crystal structures of catalytic subunit of cAMP-dependent protein kinase in complex with isoquinolinesulfonyl protein kinase inhibitors H7, H8, and H89. Structural implications for selectivity. To Reference
Ref 3Bioorg Med Chem Lett. 2003 Sep 15;13(18):3035-9.Liquid-phase synthesis of a pegylated adenosine-oligoarginine conjugate, cell-permeable inhibitor of cAMP-dependent protein kinase. To Reference
Ref 4Bioorg Med Chem Lett. 1999 May 17;9(10):1447-52.Adenosine-5'-carboxylic acid peptidyl derivatives as inhibitors of protein kinases. To Reference
Ref 5Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 6J Med Chem. 1992 Jan;35(1):177-84.Inhibitors of protein kinase C. 1. 2,3-Bisarylmaleimides. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543