Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00978

Target Information
NameCAMP-dependent protein kinase type II-beta regulatory chain    
Type of targetResearch target    
SynonymsPKA RIIbeta-subunit    
RIIbeta subunit of cAMP-dependent protein kinase    
Type RIIbeta regulatory subunit of protein kinase A    
DiseaseObesity
[ICD9: 278   ICD10: E66]
[1]
EC NumberEC 2.7.1.37
PathwayApoptosis
Insulin signaling pathway
UniProt IDP31323
FunctionType ii regulatory chains mediate membrane association by binding to anchorinG proteins, including the map2 kinase.    
SequenceMSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Target ValidationClick to Find Target Validation Information.    
Inhibitor4-[ (3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol[2]
AdcAhxArg4Lys (biotin)-PEG-OMe[3]
AdcAhxArg4Lys-PEGOMe[3]
AdcAhxArg4NH (CH2)6NH2[3]
AdcAhxArg6[3]
AdoC (Ahx)Arg6[4]
AdoC (Aoc)Arg6[4]
AdoC (Aun)Arg6[4]
AdoC (Dpr)2AlaArg6[4]
AdoC (GABA)Arg6[4]
AdoC (beta-Ala)2AlaArg6[4]
AdoC (beta-Ala)Arg6[4]
AdoC (betaAsp)2AlaArg6[4]
AdoCGlyArg6[4]
BALANOL[5]
Cyclic Adenosine Monophosphate[6]
Ro-4396686[7]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1A crystallizable form of RIIbeta regulatory domain obtained by limited proteolysis. Acta Crystallogr D Biol Crystallogr. 2000 Aug;56(Pt 8):1038-41. To Reference
Ref 2J Med Chem. 2006 Nov 2;49(22):6500-9.4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects. To Reference
Ref 3Bioorg Med Chem Lett. 2003 Sep 15;13(18):3035-9.Liquid-phase synthesis of a pegylated adenosine-oligoarginine conjugate, cell-permeable inhibitor of cAMP-dependent protein kinase. To Reference
Ref 4Bioorg Med Chem Lett. 1999 May 17;9(10):1447-52.Adenosine-5'-carboxylic acid peptidyl derivatives as inhibitors of protein kinases. To Reference
Ref 5J Med Chem. 2005 Sep 8;48(18):5613-38.Joys of molecules. 2. Endeavors in chemical biology and medicinal chemistry. To Reference
Ref 6Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 7Bioorg Med Chem Lett. 2006 Apr 1;16(7):1950-3. Epub 2006 Feb 3.Biological evaluation of a multi-targeted small molecule inhibitor of tumor-induced angiogenesis. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543