Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR00979

Target Information
NameAdenylate cyclase    
Type of targetResearch target    
SynonymsATP pyrophosphate-lyase    
Adenylyl cyclase    
DiseaseHeart failure
[ICD9: 428   ICD10: I50]
[1]
BioChemical ClassPhosphorus-oxygen lyases    
EC NumberEC 4.6.1.1
PathwayPurine metabolism
UniProt IDP00936
SequenceMYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKG ICLYTPDETQRHYLNELELYRGMSVQDPPKGELPITGVYTMGSTSSVGQSCSSDLDIWVC HQSWLDSEERQLLQRKCSLLENWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHI LLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLSSLSA EEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLD PYCMMLERVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGW DEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTR KLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESIISHQ PLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDLPKLQEMVADVSHHFPLRLPAPTP KALYSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRN SWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSE CIELRLSSTRQETGRFKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGLSV QVETNHVKLPAVVDGFASEGIIQFFFEETQDENGFNIYILDESNRVEVYHHCEGSKEELV RDVSRFYSSSHDRFTYGSSFINFNLPQFYQIVKVDGREQVIPFRTKSIGNMPPANQDHDT PLLQQYFS
Target ValidationClick to Find Target Validation Information.    
Inhibitor2,3,17BETA-TRIHYDROXY-1,3,5 (10)-ESTRATRIENE[2]
2,5-didesoxy-3-ATP[3]
2-hydroxy-17beta-estradiol[3]
Adenosine-5'-Rp-Alpha-Thio-Triphosphate[4]
Alpha,Beta-Methyleneadenosine-5'-Triphosphate[5]
Colforsin[6]
Cyclic Adenosine Monophosphate[5]
DEOXYADENOSINE[7]
N6-CYCLOPENTYLADENOSINE[8]
NSC-270718[3]
NSC-88915[3]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Adenylyl cyclase: a new target for heart failure therapeutics. Circulation. 2002 Apr 23;105(16):1876-8. To Reference
Ref 2Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 3J Med Chem. 2008 Aug 14;51(15):4456-64. Epub 2008 Jul 17.Structure-based development of novel adenylyl cyclase inhibitors. To Reference
Ref 4Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference
Ref 5Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 6Inhibition of endogenous nitric oxide synthase augments contractile response to adenylyl cyclase stimulation without altering mechanical efficiency in patients with idiopathic dilated cardiomyopathy. Circ J. 2007 Aug;71(8):1268-73. To Reference
Ref 7J Med Chem. 2004 Feb 26;47(5):1207-13.Synthesis of 2',5'-dideoxy-2-fluoroadenosine and 2',5'-dideoxy-2,5'-difluoroadenosine: potent P-site inhibitors of adenylyl cyclase. To Reference
Ref 8J Med Chem. 1991 Dec;34(12):3388-90.Activity of N6-substituted 2-chloroadenosines at A1 and A2 adenosine receptors. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543