Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01027

Target Information
NameLethal factor    
Type of targetResearch target    
SynonymsALF    
Anthrax lethal factor    
Anthrax lethal toxin endopeptidase component    
LF    
DiseaseAnthrax infection
[ICD9: 001-139, 022   ICD10: A00-B99, A22]
[1]
BioChemical ClassHydrolases acting on peptide bonds (Peptidases)    
EC NumberEC 3.4.24.83
UniProt IDP15917
PDB Structure1J7N; 1JKY; 1PWP; 1PWQ; 1PWU; 1PWV; 1PWW; 1YQY; 1ZXV; 2L0R; 3KWV; 4DV8.    
FunctionOne of the three proteins composing the anthrax toxin, the agent which infects many mammalian species and that may cause death. Lf is the lethal factor that, when associated with pa, causes death. Lf is not toxic by itself. It is a protease.    
SequenceMNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST DHAERLKVQKNAPKTFQFINDQIKFIINS
Related US Patent6,436,933
Target ValidationClick to Find Target Validation Information.    
Inhibitor3- (2,5-dimethyl-1H-pyrrol-1-yl)benzoic acid[2]
CGS-27023A[3]
GF-109203[4]
GM6001[5]
GNF-PF-600[6]
N,N'-Bis (4-Amino-2-Methylquinolin-6-Yl)Urea[5]
N,N-Dimethylsphingosine[4]
N- (3,4,5-trihydroxyphenethyl)oleamide[7]
N- (3,4-dihydroxybenzyl)oleamide[8]
N- (Sulfanylacetyl)Tyrosylprolylmethioninamide[5]
N-hydroxy-4- (2-oleamidoethyl)benzamide[7]
N-hydroxy-4- (oleamidomethyl)benzamide[8]
N-oleoyl-dopamine[7]
NSC-622445[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. To Reference
Ref 2J Med Chem. 2006 Aug 24;49(17):5232-44.Novel small-molecule inhibitors of anthrax lethal factor identified by high-throughput screening. To Reference
Ref 3Bioorg Med Chem Lett. 2006 Feb 15;16(4):964-8. Epub 2005 Dec 9.The discovery of a potent and selective lethal factor inhibitor for adjunct therapy of anthrax infection. To Reference
Ref 4Antimicrob Agents Chemother. 2007 Jul;51(7):2403-11. Epub 2007 May 7.Amiodarone and bepridil inhibit anthrax toxin entry into host cells. To Reference
Ref 5Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 6J Med Chem. 2006 Jan 12;49(1):27-30.Anthrax lethal factor protease inhibitors: synthesis, SAR, and structure-based 3D QSAR studies. To Reference
Ref 7Bioorg Med Chem Lett. 2007 Aug 15;17(16):4575-8. Epub 2007 Jun 6.Inhibitors of anthrax lethal factor. To Reference
Ref 8Bioorg Med Chem Lett. 2008 Apr 1;18(7):2467-70. Epub 2008 Feb 20.Inhibitors of anthrax lethal factor based upon N-oleoyldopamine. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543