Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01044

Target Information
NameGalanin receptor type 2    
Type of targetResearch target    
SynonymsGAL2-R    
GALR2    
DiseaseAlzheimer's disease
[ICD9: 331.0   ICD10: G30]
[1]
Central nervous system diseases
[ICD9: 294.1, 307.23, 314.00, 314.01, 320-322, 323, 331.0, 332, 333.4, 340, 344.1, 344.81, 348.0   ICD10: A83-A86, B94.1, F02.2, F02.3, F90, F95.2, G00-G37, G83.5, G93.0]
[1]
Cerebral hemorrhage[1]
Diabetes mellitus
[ICD9: 250   ICD10: E08-E13]
[1]
Diarrhea
[ICD9: 787.91   ICD10: A09, K59.1]
[1]
Eating disorders
[ICD9: 307.5   ICD10: F50]
[1]
Obesity
[ICD9: 278   ICD10: E66]
[1]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayNeuroactive ligand-receptor interaction
UniProt IDO43603
FunctionReceptor for the hormone galanin and for galp. The activity of this receptor is mediated by G proteins that activate the phospholipase c/protein kinase c pathway (via gq) and that inhibit adenylyl cyclase (via gi).    
SequenceMNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ PCILEPCPGPSWQGPKAGDSILTVDVA
Related US Patent6,407,136
Target ValidationClick to Find Target Validation Information.    
Inhibitor (Sar)WTLNSAGYLLGPKK[2]
(Sar)WTLNSAGYLLGPKK[2]
(Sar)WTLNSAGYLLGPKK[2]
(Sar)WTLNSAGYLLGPKK[2]
(Sar)WTLNSAGYLLGPKK[2]
(Sar)WTLNSAGYLLGPKK[2]
(Sar)WTLNSAGYLLGPKK[2]
(Sar)WTLNSAGYLLGPKKKK[2]
GALANIN[3]
GALANTIDE[4]
GWTLNSAGYLLGPHAV-NH2[5]
GWTLNSAGYLLGPPPALALA-CONH2[4]
GWTLNSAGYLLGPPPGFSPFR-CONH2[4]
GWTLNSAGYLLGPRHYINLITRQRY-CONH2[4]
GWTLNSAGYLLGPrPKPQQwFwLL-CONH2[4]
Gal-B5[4]
GalB2[4]
GwTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH2[4]
WTLNSAGYLL-CONH2[4]
WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2[4]
[N-Ac,des-Sar]Gal-B2[4]
[N-Me,des-Sar]Gal-B2[4]
[Sar1Ala]GAL-B2[4]
[Sar1Gly]GAL-B2[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. To Reference
Ref 2J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. To Reference
Ref 3J Med Chem. 2008 Jul 24;51(14):4150-69. Epub 2008 Jun 28.Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. To Reference
Ref 4J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. To Reference
Ref 5J Med Chem. 2008 Dec 25;51(24):8038-47.Design, synthesis, and characterization of high-affinity, systemically-active galanin analogues with potent anticonvulsant activities. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543