Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01073

Target Information
NameRetinoic acid receptor RXR-alpha    
Type of targetResearch target    
SynonymsRXRalpha    
DiseaseProstate cancer
[ICD9: 185   ICD10: C61]
[1]
BioChemical ClassZinc-finger    
PathwayAdipocytokine signaling pathway
Non-small cell lung cancer
PPAR signaling pathway
Pathways in cancer
Small cell lung cancer
Thyroid cancer
UniProt IDP19793
PDB Structure1BY4; 1DSZ; 1FBY; 1FM6; 1FM9; 1G1U; 1G5Y; 1K74; 1LBD; 1MV9; 1MVC; 1MZN; 1R0N; 1RDT; 1RXR; 1XLS; 1XV9; 1XVP; 1YNW; 2ACL; 2NLL; 2P1T; 2P1U; 2P1V; 2ZXZ; 2ZY0; 3DZU; 3DZY; 3E00; 3E94; 3FAL; 3FC6; 3FUG; 3H0A; 3KWY; 3NSP; 3NSQ; 3OAP; 3OZJ; 3PCU; 3R29; 3R2A; 3R5M; 3UVV.    
FunctionNuclear hormone receptor. Involved in retinoic acid response pathway. Binds 9-cis retinoic acid (9c-ra).    
SequenceMDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Target ValidationClick to Find Target Validation Information.    
Inhibitor (5BETA)-PREGNANE-3,20-DIONE[2]
2-chloro-5-nitro-N-phenylbenzamide[2]
AGN-34[3]
tributylstannanyl[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1RXRalpha: a novel target for prostate cancer. Cancer Biol Ther. 2003 Mar-Apr;2(2):185-6. To Reference
Ref 2Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 3J Med Chem. 2005 Aug 25;48(17):5383-403.Farnesoid X receptor: from structure to potential clinical applications. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543