Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01132

Target Information
NameGlucose 6-phosphate translocase    
Type of targetResearch target    
SynonymsGlucose 5-phosphate transporter    
Glucose-6-phosphate translocase    
PRO0685    
Solute carrier family 37 member 4    
DiseaseNoninsulin-dependent diabetes mellitus
[ICD9: 250   ICD10: E08-E13]
[1]
BioChemical ClassTransmembrane protein    
UniProt IDO43826
SequenceMAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAY AISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPP CGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCVVVS FLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVK TCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPN LCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTK MGRVSKKAE
InhibitorChlorogenic acid[2]
Kodaistatin A[3]
Kodaistatin C[3]
Mumbaistatin[4][5]
S 0957[6]
S 1743[6]
S 3025[7]
S-4048[8][9][10][11]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Engineered biosynthesis of regioselectively modified aromatic polyketides using bimodular polyketide synthases. PLoS Biol. 2004 Feb;2(2):E31. Epub 2004 Feb 17. To Reference
Ref 2Chlorogenic acid and synthetic chlorogenic acid derivatives: novel inhibitors of hepatic glucose-6-phosphate translocase. J Med Chem. 1997 Jan 17;40(2):137-45. To Reference
Ref 3Kodaistatins, novel inhibitors of glucose-6-phosphate translocase T1 from Aspergillus terreus thom DSM 11247. Isolation and structural elucidation. J Antibiot (Tokyo). 2000 Jul;53(7):677-86. To Reference
Ref 4Studies toward the total synthesis of mumbaistatin, a highly potent glucose-6-phosphate translocase inhibitor. Synthesis of a mumbaistatin analogue. J Org Chem. 2002 Dec 27;67(26):9248-56. To Reference
Ref 5The chemical structure of mumbaistatin, a novel glucose-6-phosphate translocase inhibitor produced by Streptomyces sp. DSM 11641. J Antibiot (Tokyo). 2001 Apr;54(4):354-63. To Reference
Ref 6Identification of protein components of the microsomal glucose 6-phosphate transporter by photoaffinity labelling. Biochem J. 1999 May 1;339 ( Pt 3):629-38. To Reference
Ref 7Prolonged blood glucose reduction in mrp-2 deficient rats (GY/TR(-)) by the glucose-6-phosphate translocase inhibitor S 3025. Biochim Biophys Acta. 2002 Jan 15;1569(1-3):105-10. To Reference
Ref 8Glucose release from GLUT2-null hepatocytes: characterization of a major and a minor pathway. Am J Physiol Endocrinol Metab. 2002 Apr;282(4):E794-801. To Reference
Ref 9Normal kinetics of intestinal glucose absorption in the absence of GLUT2: evidence for a transport pathway requiring glucose phosphorylation and transfer into the endoplasmic reticulum. Proc Natl Acad Sci U S A. 2001 Sep 25;98(20):11330-5. Epub 2001 Sep 18. To Reference
Ref 10Fatty acid and amino acid modulation of glucose cycling in isolated rat hepatocytes. Biochem J. 2001 Sep 15;358(Pt 3):665-71. To Reference
Ref 11Alterations of carbohydrate and lipid intermediary metabolism during inhibition of glucose-6-phosphatase in rats. Eur J Pharmacol. 1999 Dec 10;386(1):75-82. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543