Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01179

Target Information
NameSodium- and chloride-dependent GABA transporter 1    
Type of targetResearch target    
SynonymsGABA transporter 1    
DiseaseConvulsions
[ICD9: 780.3   ICD10: R56.0]
[1]
Psychosis
[ICD9: 290-299   ICD10: F20-F29]
[2]
BioChemical ClassTransmembrane protein    
UniProt IDP30531
FunctionTerminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.    
SequenceMATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFDFLMSCVGY AIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAP MFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMV NTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWILVYFCIWKGVGWTGKVV YFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL GSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASG PGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQFCTVEGFITALVDEYPRLLRNRR ELFIAAVCIISYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRF YDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFIFSAVQMTPLTMGNYVFPKWGQGVGWLM ALSSMVLIPGYMAYMFLTLKGSLKQRIQVMVQPSEDIVRPENGPEQPQAGSSTSKEAYI
Target ValidationClick to Find Target Validation Information.    
Inhibitor (R)-Piperidine-3-carboxylic acid[3]
(S)-Piperidine-3-carboxylic acid[3]
2,4-Diamino-butyric acid (GABA)[4]
4-Hydroxy-piperidine-3-carboxylic acid[5]
GAMMA-AMINO-BUTANOIC ACID[3]
NIPECOTIC ACID[6]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1GABA-level increasing and anticonvulsant effects of three different GABA uptake inhibitors. Neuropharmacology. 2000 Sep;39(12):2399-407. To Reference
Ref 2Tiagabine, a specific gamma-aminobutyric acid transporter-1 inhibitor, in the treatment of psychosis. J Clin Psychopharmacol. 2001 Jun;21(3):347-9. To Reference
Ref 3J Med Chem. 2004 Nov 4;47(23):5620-9.Novel secoergoline derivatives inhibit both GABA and glutamate uptake in rat brain homogenates: synthesis, in vitro pharmacology, and modeling. To Reference
Ref 4J Med Chem. 1986 Feb;29(2):224-9.Glycine antagonists. Synthesis, structure, and biological effects of some bicyclic 5-isoxazolol zwitterions. To Reference
Ref 5J Med Chem. 1982 Oct;25(10):1157-62.Hydroxy- and amino-substituted piperidinecarboxylic acids as gamma-aminobutyric acid agonists and uptake inhibitors. To Reference
Ref 6J Med Chem. 1981 Jul;24(7):788-94.Epimeric cis-decahydroquinoline-5-carboxylic acids: effects on gamma-aminobutyric acid uptake and receptor binding in vitro. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543