Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01180

Target Information
NameAlpha-2C adrenergic receptor    
Type of targetResearch target    
SynonymsAlpha-2C adrenoceptor    
Alpha-2C adrenoreceptor    
Subtype C4    
DiseaseNeuropsychiatric disorders[1]
Raynaud's syndrome
[ICD9: 443.0   ICD10: I73.0]
[2]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayNeuroactive ligand-receptor interaction
UniProt IDP18825
FunctionAlpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.    
SequenceMASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Related US Patent6,593,324
Target ValidationClick to Find Target Validation Information.    
Inhibitor (+/-)-nantenine[3]
(1,2,3,4-Tetrahydro-isoquinolin-3-yl)-methanol[4]
(1H-Benzoimidazol-5-yl)-[5]
(1H-Imidazol-2-yl)-quinoxalin-6-yl-amine[5]
(2,6-Dichloro-phenyl)-[5]
(2-Bromo-phenyl)-[5]
(2-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine[6]
(3-Ethyl-indol-1-yl)-propyl-pyridin-4-yl-amine[6]
(3-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine[6]
(R)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline[7]
(S)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline[7]
1,2,3,4,4a,5,10,10a-Octahydro-benzo[g]quinoline[8]
1,2,3,4,5,6-Hexahydro-benzo[c]azocine[7]
1,2,3,4-Tetrahydro-benzo[h]isoquinolin-8-ol[9]
1,2,3,4-Tetrahydro-isoquinolin-7-ol[9]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole[10]
1,2,3,4-tetrahydroisoquinoline[11]
1- ([12]
2,3,4,5-Tetrahydro-1H-benzo[c]azepine[7]
2,3,4,5-Tetrahydro-1H-benzo[e][1,4]diazepine[7]
2,3,4,5-Tetrahydro-benzo[f][1,4]oxazepine[7]
2,3-Dihydro-1H-isoindole[7]
2-Benzofuran-2-yl-4,5-dihydro-1H-imidazole[13]
3-Fluoromethyl-1,2,3,4-tetrahydro-isoquinoline[14]
3-Methoxymethyl-1,2,3,4-tetrahydro-isoquinoline[4]
3-Methyl-1,2,3,4-tetrahydro-isoquinoline[7]
4- (1-Naphthalen-1-yl-ethyl)-1H-imidazole[15]
4- (4-Methyl-indan-1-yl)-1H-imidazole[16]
5-Aminomethyl-naphthalen-2-ol[9]
6,7,8,9-Tetrahydro-5-thia-8-aza-benzocycloheptene[7]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline[17]
8-Methoxy-1,2,3,4-tetrahydro-benzo[h]isoquinoline[9]
A-80426[18]
Butyl-indol-1-yl-pyridin-4-yl-amine[6]
C- (6-Methoxy-naphthalen-1-yl)-methylamine[9]
C-Naphthalen-1-yl-methylamine[9]
CONESSINE[19]
Ethyl-indol-1-yl-pyridin-4-yl-amine[6]
GNF-PF-2857[20]
GNF-PF-3427[20]
GNF-PF-3878[20]
INDORAMIN[21]
Indol-1-yl-methyl-pyridin-4-yl-amine[6]
Indol-1-yl-prop-2-ynyl-pyridin-4-yl-amine[6]
Indol-1-yl-propyl-pyridin-4-yl-amine[6]
Indol-1-yl-pyridin-4-yl-amine[6]
MAZAPERTINE[22]
MEDETOMIDINE[15]
METHYLNORADRENALINE[23]
MEZILAMINE[24]
MOXONIDINE[25]
PIPEROXAN[23]
R-226161[26]
RX-821002[27]
S-34324[18]
SK&F-104078,   SK-104078[21]
SK&F-64139,   SK-64139[11]
SNAP-5089[28]
SNAP-5150[28]
TRACIZOLINE[17]
TRAMAZOLINE[23]
TRYPTOLINE[17]
WB-4101[23]
Yohimbine Hydrochloride[29]
AgonistChloroethylclonidine[30]
AntagonistARC239[31]
Ciproxifan[32]
MK-912[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Evaluation of the alpha2C-adrenoceptor as a neuropsychiatric drug target studies in transgenic mouse models. Life Sci. 2001 Apr 6;68(19-20):2277-85. To Reference
Ref 2Silent alpha(2C)-adrenergic receptors enable cold-induced vasoconstriction in cutaneous arteries. Am J Physiol Heart Circ Physiol. 2000 Apr;278(4):H1075-83. To Reference
Ref 3Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. To Reference
Ref 4J Med Chem. 1999 Jun 3;42(11):1982-90.3,7-Disubstituted-1,2,3,4-tetrahydroisoquinolines display remarkable potency and selectivity as inhibitors of phenylethanolamine N-methyltransferase versus the alpha2-adrenoceptor. To Reference
Ref 5J Med Chem. 1997 Jan 3;40(1):18-23.Synthesis and evaluation of 2-(arylamino)imidazoles as alpha 2-adrenergic agonists. To Reference
Ref 6J Med Chem. 1996 Jan 19;39(2):570-81.Synthesis and structure-activity relationships of N-propyl-N-(4-pyridinyl)-1H-indol-1-amine (besipirdine) and related analogs as potential therapeutic agents for Alzheimer's disease. To Reference
Ref 7J Med Chem. 1996 Aug 30;39(18):3539-46.Effect of ring size or an additional heteroatom on the potency and selectivity of bicyclic benzylamine-type inhibitors of phenylethanolamine N-methyltransferase. To Reference
Ref 8J Med Chem. 1998 Oct 8;41(21):4165-70.N-(Iodopropenyl)-octahydrobenzo[f]- and -[g]quinolines: synthesis and adrenergic and dopaminergic activity studies. To Reference
Ref 9J Med Chem. 1997 Dec 5;40(25):3997-4005.Examination of the role of the acidic hydrogen in imparting selectivity of 7-(aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline (SK&F 29661) toward inhibition of phenylethanolamine N-methyltransferase vs the alpha 2-adrenoceptor. To Reference
Ref 10Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. To Reference
Ref 11J Med Chem. 2006 Sep 7;49(18):5424-33.Comparison of the binding of 3-fluoromethyl-7-sulfonyl-1,2,3,4-tetrahydroisoquinolines with their isosteric sulfonamides to the active site of phenylethanolamine N-methyltransferase. To Reference
Ref 12J Med Chem. 2006 Jan 12;49(1):318-28.1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. To Reference
Ref 13Bioorg Med Chem Lett. 2000 Mar 20;10(6):605-7.Probes for imidazoline binding sites: synthesis and evaluation of a selective, irreversible I2 ligand. To Reference
Ref 14J Med Chem. 2005 Jan 13;48(1):134-40.3-hydroxymethyl-7-(N-substituted aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline inhibitors of phenylethanolamine N-methyltransferase that display remarkable potency and selectivity. To Reference
Ref 15J Med Chem. 1994 Jul 22;37(15):2328-33.A structure-activity relationship study of benzylic modifications of 4-[1-(1-naphthyl)ethyl]-1H-imidazoles on alpha 1- and alpha 2-adrenergic receptors. To Reference
Ref 16J Med Chem. 1997 Sep 12;40(19):3014-24.Medetomidine analogs as alpha 2-adrenergic ligands. 3. Synthesis and biological evaluation of a new series of medetomidine analogs and their potential binding interactions with alpha 2-adrenoceptors involving a "methyl pocket". To Reference
Ref 17Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.Binding of an imidazopyridoindole at imidazoline I2 receptors. To Reference
Ref 18J Med Chem. 2005 Mar 24;48(6):2054-71.Discovery of a new series of centrally active tricyclic isoxazoles combining serotonin (5-HT) reuptake inhibition with alpha2-adrenoceptor blocking activity. To Reference
Ref 19J Med Chem. 2008 Sep 11;51(17):5423-30. Epub 2008 Aug 7.The alkaloid conessine and analogues as potent histamine H3 receptor antagonists. To Reference
Ref 20J Med Chem. 2006 Oct 19;49(21):6351-63.Structure-activity relationship of quinoline derivatives as potent and selective alpha(2C)-adrenoceptor antagonists. To Reference
Ref 21J Med Chem. 1995 Sep 1;38(18):3415-44.Alpha- and beta-adrenoceptors: from the gene to the clinic. 1. Molecular biology and adrenoceptor subclassification. To Reference
Ref 22J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. To Reference
Ref 23J Med Chem. 1982 Dec;25(12):1389-401.alpha 2 adrenoceptors: classification, localization, mechanisms, and targets for drugs. To Reference
Ref 24J Med Chem. 1986 Aug;29(8):1394-8.4-Amino-6-chloro-2-piperazinopyrimidines with selective affinity for alpha 2-adrenoceptors. To Reference
Ref 25J Med Chem. 1996 Mar 15;39(6):1193-5.Synthesis and pharmacologic evaluation of 2-endo-amino-3-exo-isopropylbicyclo[2.2.1]heptane: a potent imidazoline1 receptor specific agent. To Reference
Ref 26Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. Epub 2007 Mar 21.Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-adrenoceptor antagonism. To Reference
Ref 27J Med Chem. 1986 Oct;29(10):2000-3.Alpha-adrenoreceptor reagents. 4. Resolution of some potent selective prejunctional alpha 2-adrenoreceptor antagonists. To Reference
Ref 28Bioorg Med Chem Lett. 1999 Oct 4;9(19):2843-8.Design and synthesis of novel dihydropyridine alpha-1a antagonists. To Reference
Ref 29J Med Chem. 2009 Dec 10;52(23):7397-409.Further studies on arylpiperazinyl alkyl pyridazinones: discovery of an exceptionally potent, orally active, antinociceptive agent in thermally induced pain. To Reference
Ref 30Selective irreversible binding of chloroethylclonidine at alpha 1- and alpha 2-adrenoceptor subtypes. Mol Pharmacol. 1993 Dec;44(6):1165-70. To Reference
Ref 31Potent alpha(2A)-adrenoceptor-mediated vasoconstriction by brimonidine in porcine ciliary arteries. Invest Ophthalmol Vis Sci. 2001 Aug;42(9):2049-55. To Reference
Ref 32The histamine H3 receptor: from gene cloning to H3 receptor drugs. Nat Rev Drug Discov. 2005 Feb;4(2):107-20. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543