Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01197

Target Information
NameThyrotropin-releasing hormone receptor    
Type of targetResearch target    
SynonymsTRH-R    
Thyroliberin receptor    
DiseaseAlcohol dependence
[ICD9: 303   ICD10: F10.2]
[1]
Anxiety disorder, unspecified
[ICD9: 300   ICD10: F40-F42]
[2]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayCalcium signaling pathway
Neuroactive ligand-receptor interaction
UniProt IDP34981
FunctionReceptor for thyrotropin-releasing hormone. This receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.    
SequenceMENETVSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPT NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCG YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH QNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKES DHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
InhibitorCORYMBONE B[3]
PROTIRELIN[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1The psychiatric management of patients with alcohol dependence. Curr Treat Options Neurol. 2007 Sep;9(5):381-92. To Reference
Ref 2Antidepressants alleviate the impact of reinforcer downshift. Eur Neuropsychopharmacol. 2009 Jan;19(1):41-8. Epub 2008 Sep 20. To Reference
Ref 3J Nat Prod. 2008 May;71(5):881-3. Epub 2008 Apr 16.Corymbones A and B, phloroglucinols with thyrotropin releasing hormone receptor 2 binding affinity from the flowers of Corymbia peltata. To Reference
Ref 4J Nat Prod. 2008 May;71(5):884-6. Epub 2008 Apr 12.Spongian diterpenes with thyrotropin releasing hormone receptor 2 binding affinity from Spongia sp. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543