Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01201

Target Information
NamePyridoxal kinase    
Type of targetResearch target    
SynonymsPyridoxine kinase    
DiseaseAsthma
[ICD9: 493   ICD10: J45]
[1]
Korsakov's alcoholic psychosis
[ICD9: 290-299   ICD10: F20-F29]
[2]
Vitamin B6 deficiency
[ICD9: 266.1   ICD10: E53.1]
[3]
BioChemical ClassTransferases transferring phosphorus-containing groups    
EC NumberEC 2.7.1.35
PathwayMetabolic pathways
Vitamin B6 metabolism
UniProt IDO00764
PDB Structure2AJP; 2F7K; 2YXT; 2YXU; 3FHX; 3FHY; 3KEU; 4EN4; 4EOH.    
FunctionRequired for synthesis of pyridoxal-5-phosphate from vitamin B6.    
SequenceMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSD ELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKW DGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGP DTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAM LLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDI EDPEIVVQATVL
InhibitorAdenosine-5'-Diphosphate[4]
Adenosine-5'-[Beta, Gamma-Methylene]Triphosphate[5]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Effect of low-dose theophylline plus beclometasone on lung function in smokers with asthma: a pilot study. Eur Respir J. 2009 May;33(5):1010-7. Epub 2009 Feb 5. To Reference
Ref 2Thiamine status in liver and brain of rats genetically selected for different sensitivity to hypnotic effect of alcohol. Alcohol Clin Exp Res. 2000 Nov;24(11):1620-4. To Reference
Ref 3Human brain pyridoxal-5'-phosphate phosphatase: production and characterization of monoclonal antibodies. J Biochem Mol Biol. 2005 Nov 30;38(6):703-8. To Reference
Ref 4Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference
Ref 5Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543