Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01203

Target Information
NameSoluble epoxide hydrolase    
Type of targetClinical trial target    
SynonymsCEH    
Cytosolic epoxide hydrolase    
Epoxide Hydrolase    
Epoxide hydratase    
SEH    
DiseaseCardiovascular disease, unspecified
[ICD9: 390-459   ICD10: I00-I99]
[1]
Hypertension
[ICD9: 401   ICD10: I10, I11, I12, I13, I15]
[2]
Renal diseases
[ICD9: 580-599   ICD10: N00-N39]
[3]
BioChemical ClassHydrolases acting on ether bonds    
EC NumberEC 3.3.2.3
PathwayArachidonic acid metabolism
Metabolic pathways
Tetrachloroethene degradation
UniProt IDP34913
PDB Structure1S8O; 1VJ5; 1ZD2; 1ZD3; 1ZD4; 1ZD5; 3ANS; 3ANT; 3I1Y; 3I28; 3KOO; 3OTQ; 3PDC; 4HAI; 4J03; 4JNC.    
FunctionThis enzyme acts on epoxides (alkene oxides, oxiranes) and arene oxides. plays a role in xenobiotic metabolism by degrading potential toxic epoxides. also determines steady- state levels of physiological mediators.    
SequenceMTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK WLDSDARNPPVVSKM
Related US Patent6,531,506
Target ValidationClick to Find Target Validation Information.    
Inhibitor1,3-DIPHENYLUREA[4]
1- (1-Adamantyl)-3-[5]
1- (1-Propionylpiperidin-4-yl)-3-m-tolylurea[5]
1- (1-Propionylpiperidin-4-yl)-3-o-tolylurea[5]
1- (1-Propionylpiperidin-4-yl)-3-p-tolylurea[5]
1- (3-[6]
1- (3-Chloro-phenyl)-3-[7]
1- (3-Chloro-phenyl)-3-cyclohexyl-urea[7]
1- (4-[6]
1-Adamantan-1-yl-3- (2-hydroxy-phenyl)-urea[8]
1-Adamantan-1-yl-3- (2-methoxy-phenyl)-urea[8]
1-Adamantan-1-yl-3- (3-hydroxy-phenyl)-urea[8]
1-Adamantan-1-yl-3- (3-methoxy-phenyl)-urea[8]
1-Adamantan-1-yl-3- (4-hydroxy-decyl)-urea[7]
1-Adamantan-1-yl-3- (4-hydroxy-phenyl)-urea[8]
1-Adamantan-1-yl-3- (4-methoxy-phenyl)-urea[8]
1-Adamantan-1-yl-3-decyl-urea[7]
1-Adamantan-1-yl-3-phenyl-urea[8]
1-Cycloheptyl-3- (1-propionylpiperidin-4-yl)urea[5]
1-Cyclohexyl-3- (1-propionylpiperidin-4-yl)urea[5]
1-Cyclohexyl-3- (4-methoxy-phenyl)-urea[7]
1-Cyclohexyl-3-phenethyl-urea[7]
1-Cyclohexyl-3-phenyl-urea[7]
1-Octyl-3- (1-propionylpiperidin-4-yl)urea[5]
1-Phenyl-3- (1-propionylpiperidin-4-yl)urea[5]
1-adamantan-1-yl-3- ([9]
1-adamantan-1-yl-3- (1-benzyl-piperidin-4-yl)-urea[10]
1-adamantan-1-yl-3- (1-butyl-piperidin-4-yl)-urea[10]
1-adamantan-1-yl-3- (1-ethyl-piperidin-4-yl)-urea[10]
1-adamantan-1-yl-3- (1-propyl-piperidin-4-yl)-urea[10]
1-adamantan-1-yl-3- (2-heptyloxyethyl)urea[11]
1-adamantan-1-yl-3- (2-hydroxyethyl)urea[11]
1-adamantan-1-yl-3- (3-hexyloxypropyl)urea[11]
1-adamantan-1-yl-3- (3-hydroxypropyl)urea[11]
1-adamantan-1-yl-3- (4-hydroxybutyl)urea[11]
1-adamantan-1-yl-3- (4-pentyloxybutyl)urea[11]
1-adamantan-1-yl-3- (4-pentyloxycylclohexyl)urea[11]
1-adamantan-1-yl-3- (5-butoxypentyl)urea[11]
1-adamantan-1-yl-3- (5-hydroxypentyl)urea[11]
1-adamantan-1-yl-3- (6-hydroxyhexyl)urea[11]
1-adamantan-1-yl-3- (6-propyloxyhexyl)urea[11]
1-adamantan-1-yl-3-[4- (4-fluorophenoxy)butyl]urea[12]
1-adamantan-1-yl-3-piperidin-4-yl-urea[10]
1-adamantan-1-yl-3-piperidin-4-ylmethyl-urea[10]
12- (3-Adamantan-1-yl-ureido)-dodeca noic acid[13]
12- (3-n-Hexylureido)dodec-8[14]
12- (3-n-Pentylureidooxy)dodec-8[14]
13- (3-Pentyluredo)tridec-8[14]
13- (3-n-Pentylthioureido)tridec-8[14]
13- (3-n-Pentylureido)tridec-5[14]
13- (3-n-Pentylureido)tridec-8[14]
13- (3-n-Pentylureido)tridec-8-ynoic acid[14]
13- (5-n-Pentylfuran-2-yl)tridec-8[14]
13- (N-Isopropylheptanamido)tridec-8[14]
13- (N-Methyl-n-heptnamido)tridec-8[14]
13- (n-Pentylcarbamoyloxy)tridec-8[14]
13-n-Heptanamidotridec-5-ynoic acid[14]
13-n-Heptanamidotridec-8 (Z)-enoic acid[14]
14- (n-Hexylamino)-14-oxotetradec-8[14]
16- (3-Ethylureido)hexadec-11[14]
2-Adamantan-1-yl-N-decyl-acetamide[7]
2-Cyclohexyl-N- (4-methoxy-phenyl)-acetamide[7]
2-Cyclohexyl-N-phenethyl-acetamide[7]
2-Cyclohexyl-N-phenyl-acetamide[7]
3- (3-Adamantan-1-yl-ureido)-benzoic acid[8]
4,4-Diphenyl-N- (pyridin-3-yl)-butyramide[15]
4- (3-Adamantan-1-yl-ureido)-benzoic acid[8]
4- (3-cyclohexylureido)butanoic acid[16]
4-{[ (CYCLOHEXYLAMINO)CARBONYL]AMINO}BUTANOIC ACID[4]
6-amino-N- (2,4-dichlorobenzyl)nicotinamide[17]
6-amino-N- (3,3-diphenylpropyl)nicotinamide[17]
6-{[ (CYCLOHEXYLAMINO)CARBONYL]AMINO}HEXANOIC ACID[4]
9- (3-n-Pentylureido)non-4[14]
9- (3-n-Pentylureido)non-4-ynoic acid[14]
Dodecanoic acid adamantan-1-ylamide[7]
Methyl 14- (3-n-butylureido)tetradec-8[14]
N,N'-dicyclohexyl-urea[12]
N- (1-acetylpiperidin-4-yl)-N'-[12]
N- (3,3-Diphenyl-propyl)-2-pyridine-3-ylacetamide[15]
N- (3,3-Diphenyl-propyl)-isonicotinamide[15]
N- (3,3-diphenyl-propyl)-nicotinamide[15]
N- (3-Chloro-phenyl)-2-cyclohexyl-acetamide[7]
N- (3-Phenyl-propyl)-nicotinamide[15]
N- (4,4-Diphenyl-butyl)-nicotinamide[15]
N- (biphenyl-3-yl)benzo[d]isoxazol-3-amine[18]
N- (biphenyl-4-yl)benzo[d]isoxazol-3-amine[18]
N- (naphthalen-1-yl)benzo[d]isoxazol-3-amine[18]
N- (naphthalen-2-yl)benzo[d]isoxazol-3-amine[18]
N-Cyclohexyl-2- (4-methoxy-phenyl)-acetamide[7]
N-Cyclohexyl-2-phenyl-acetamide[7]
N-Cyclohexyl-4-phenyl-butyramide[7]
N-Cyclohexyl-N'- (4-Iodophenyl)Urea[19]
N-Cyclohexyl-N'- (Propyl)Phenyl Urea[4]
N-Cyclohexyl-N'-Decylurea[4]
N-[ (CYCLOHEXYLAMINO)CARBONYL]GLYCINE[4]
N-[3,3-Bis- (4-fluorophenyl)-propyl]-benzamide[15]
N-[3,3-Bis- (4-fluorophenyl)-propyl]-nicotinamide[15]
N-adamantyl-N'-cyclohexylurea[12]
N-benzyl-6- (3,3,3-trifluoropropoxy)nicotinamide[17]
[4- (3-Adamantan-1-yl-ureido)-phenyl]-acetic acid[8]
cis-1-adamantan-1-yl-3- (4-hydroxycyclohexyl)urea[12]
cis-1-adamantan-1-yl-3- (4-methoxycyclohexyl)urea[12]
methyl 4- (3-cyclohexylureido)butanoate[16]
methyl 6- (3-cyclohexylureido)hexanoate[16]
trans,trans-1,3-bis- (4-hydroxycyclohexyl)urea[12]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Alteration in plasma testosterone levels in male mice lacking soluble epoxide hydrolase. Am J Physiol Endocrinol Metab. 2009 Aug;297(2):E375-83. Epub 2009 May 19. To Reference
Ref 2Targeted disruption of soluble epoxide hydrolase reveals a role in blood pressure regulation. J Biol Chem. 2000 Dec 22;275(51):40504-10. To Reference
Ref 3Epoxide hydrolase and epoxygenase metabolites as therapeutic targets for renal diseases. Am J Physiol Renal Physiol. 2005 Sep;289(3):F496-503. To Reference
Ref 4Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 5J Med Chem. 2010 Oct 14;53(19):7067-75.1-Aryl-3-(1-acylpiperidin-4-yl)urea inhibitors of human and murine soluble epoxide hydrolase: structure-activity relationships, pharmacokinetics, and reduction of inflammatory pain. To Reference
Ref 6Bioorg Med Chem Lett. 2009 Aug 1;19(15):4259-63. Epub 2009 May 30.Unsymmetrical non-adamantyl N,N'-diaryl urea and amide inhibitors of soluble expoxide hydrolase. To Reference
Ref 7J Med Chem. 2005 May 19;48(10):3621-9.Optimization of amide-based inhibitors of soluble epoxide hydrolase with improved water solubility. To Reference
Ref 8Bioorg Med Chem Lett. 2009 Mar 15;19(6):1784-9. Epub 2009 Jan 27.Salicylate-urea-based soluble epoxide hydrolase inhibitors with high metabolic and chemical stabilities. To Reference
Ref 9Bioorg Med Chem Lett. 2006 Nov 15;16(22):5773-7. Epub 2006 Sep 1.Solid-phase combinatorial approach for the optimization of soluble epoxide hydrolase inhibitors. To Reference
Ref 10Bioorg Med Chem Lett. 2006 Oct 1;16(19):5212-6. Epub 2006 Jul 25.Synthesis and SAR of conformationally restricted inhibitors of soluble epoxide hydrolase. To Reference
Ref 11J Med Chem. 2007 Oct 18;50(21):5217-26. Epub 2007 Sep 26.1,3-disubstituted ureas functionalized with ether groups are potent inhibitors of the soluble epoxide hydrolase with improved pharmacokinetic properties. To Reference
Ref 12J Med Chem. 2007 Aug 9;50(16):3825-40. Epub 2007 Jul 6.Orally bioavailable potent soluble epoxide hydrolase inhibitors. To Reference
Ref 13J Med Chem. 2009 Aug 27;52(16):5009-12.Discovery of a highly potent, selective, and bioavailable soluble epoxide hydrolase inhibitor with excellent ex vivo target engagement. To Reference
Ref 14J Med Chem. 2009 Aug 27;52(16):5069-75.14,15-Epoxyeicosa-5,8,11-trienoic acid (14,15-EET) surrogates containing epoxide bioisosteres: influence upon vascular relaxation and soluble epoxide hydrolase inhibition. To Reference
Ref 15J Med Chem. 2009 Oct 8;52(19):5880-95.Structure-based optimization of arylamides as inhibitors of soluble epoxide hydrolase. To Reference
Ref 16Bioorg Med Chem Lett. 2006 Oct 15;16(20):5439-44.Peptidyl-urea based inhibitors of soluble epoxide hydrolases. To Reference
Ref 17Bioorg Med Chem Lett. 2009 Oct 15;19(20):5864-8. Epub 2009 Aug 26.Design and synthesis of substituted nicotinamides as inhibitors of soluble epoxide hydrolase. To Reference
Ref 18Bioorg Med Chem Lett. 2009 Oct 1;19(19):5716-21. Epub 2009 Aug 7.A strategy of employing aminoheterocycles as amide mimics to identify novel, potent and bioavailable soluble epoxide hydrolase inhibitors. To Reference
Ref 19Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543