Target
Information |
Name | Carbonic anhydrase I |
Type of target | Research target |
Synonyms | CA-I |
Carbonate dehydratase I |
Carbonic anhydrase B |
Disease | Glaucoma [ICD9: 365 ICD10: H40-H42] | [1] |
Hypertension [ICD9: 401 ICD10: I10, I11, I12, I13, I15] | [2] |
Pancreatic cancer [ICD9: 157 ICD10: C25] | [3] |
BioChemical Class | Carbon-oxygen lyases |
EC Number | EC 4.2.1.1 |
Pathway | Nitrogen metabolism |
UniProt ID | P00915 |
PDB Structure | 1AZM; 1BZM; 1CRM; 1CZM; 1HCB; 1HUG; 1HUH; 1J9W; 1JV0; 2CAB; 2FOY; 2FW4; 2IT4; 2NMX; 2NN1; 2NN7; 3LXE; 3W6H; 3W6I. |
Function | Reversible hydration of carbon dioxide. |
Sequence | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
|
Target Validation | Click to Find Target Validation Information. |
QSAR Model | Click to Find Target QSAR Model. |
Inhibitor | 2,4-dichloro-5-sulfamoylbenzoic acid |  | [4] |
2- (biphenyl-4-yl)vinylboronic acid |  | [5] |
2-Hydroxycinnamic acid |  | [6] |
2-oxo-2H-thiochromene-3-carboxylic acid |  | [7] |
3-phenylprop-1-enylboronic acid |  | [5] |
4-azidobenzenesulfonamide |  | [8] |
4-bromophenylboronic acid |  | [5] |
4-butylphenylboronic acid |  | [5] |
4-ethynyl benzene sulfonamide |  | [9] |
4-methoxyphenylboronic acid |  | [5] |
4-methylstyrylboronic acid |  | [5] |
4-nitrophenyl phosphate |  | [10] |
4-phenoxyphenylboronic acid |  | [5] |
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid |  | [7] |
Aminobenzolamide derivative |  | [11] |
Azide |  | [12] |
BENZENESULFONAMIDE |  | [13] |
BENZOLAMIDE |  | [14] |
CATECHIN |  | [6] |
CHLORIDE |  | [15] |
COUMARIN |  | [16] |
COUMATE |  | [17] |
CURCUMIN |  | [6] |
CYANATE |  | [12] |
Cynooxide anion |  | [18] |
Ditiocarb sodium |  | [19] |
ELLAGIC ACID |  | [20] |
EMATE |  | [21] |
FERULIC ACID |  | [20] |
GALLICACID |  | [20] |
HERNIARIN |  | [7] |
HYDROSULFIDE |  | [12] |
INDISULAM |  | [22] |
IODIDE |  | [15] |
Indan-5-sulfonic acid amide |  | [23] |
N- (prop-2-ynyl)-4-sulfamoylbenzamide |  | [24] |
N-hydroxysulfamide |  | [25] |
N-hydroxysulfonamides |  | [26] |
N-unsubstituted carbamate esters |  | [27] |
NITRATE |  | [15] |
NSC-654077 |  | [28] |
PARABEN |  | [20] |
PARAOXON |  | [10] |
PHENOL |  | [6] |
PHENYLDIFLUOROMETHANESULFONAMIDE |  | [21] |
PHENYLMETHANESULFONAMIDE |  | [21] |
PHENYLSULFAMATE |  | [21] |
Phenyl Boronic acid |  | [15] |
SACCHARIN |  | [29] |
SALICYLATE |  | [30] |
SULFAMATE |  | [15] |
SULFAMIDE |  | [15] |
SULFATE |  | [15] |
Sulfenamido-sulfonamides |  | [31] |
Syringic Acid |  | [20] |
Thioureido sulfonamide |  | [32] |
Thioureido sulfonamide |  | [32] |
Thioureido sulfonamide |  | [32] |
[Au (CN)2]- |  | [33] |
[Cu (CN)2]- |  | [33] |
beta-naphthylboronic acid |  | [5] |
biphenylboronic acid |  | [5] |
decyl sulfamate |  | [34] |
hexane-1,6-diamine |  | [35] |
octyl sulfamate |  | [34] |
p-Coumaric Acid |  | [20] |
pentane-1,5-diamine |  | [35] |
phenethylboronic acid |  | [5] |
phenoxyarsonous acid |  | [15] |
prop-2-ynyl 4-sulfamoylbenzoate |  | [24] |
sodium trithiocarbonate |  | [19] |
styrylboronic acid |  | [5] |
sulfanilamide derivative |  | [36] |
Cross References |
3D Structure
Related Literature
On-Line
Medical Dictionary |
Ref 1 | Carbonic anhydrase inhibitors: synthesis and inhibition against isozymes I, II and IV of topically acting antiglaucoma sulfonamides incorporating cis-5-norbornene-endo-3-carboxy-2-carboxamido moieties. J Enzyme Inhib. 2001;16(2):113-23. To Reference |
Ref 2 | Calcium channel blockers reduce blood pressure in part by inhibiting vascular smooth muscle carbonic anhydrase I. Cardiovasc Drugs Ther. 2000 Oct;14(5):523-8. To Reference |
Ref 3 | Immunohistochemical demonstration of the carbonic anhydrase isoenzymes I and II in pancreatic tumours. Histochem J. 1995 Feb;27(2):133-8. To Reference |
Ref 4 | Bioorg Med Chem. 2010 Jan 15;18(2):930-8. Epub 2009 Nov 20.Synthesis, characterization and antiglaucoma activity of a novel proton transfer compound and a mixed-ligand Zn(II) complex. To Reference |
Ref 5 | Bioorg Med Chem Lett. 2009 May 15;19(10):2642-5. Epub 2009 Apr 5.Carbonic anhydrase inhibitors. Inhibition of the fungal beta-carbonic anhydrases from Candida albicans and Cryptococcus neoformans with boronic acids. To Reference |
Ref 6 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. To Reference |
Ref 7 | J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. To Reference |
Ref 8 | Bioorg Med Chem Lett. 2008 Aug 15;18(16):4624-7. Epub 2008 Jul 10.Inhibition of human mitochondrial carbonic anhydrases VA and VB with para-(4-phenyltriazole-1-yl)-benzenesulfonamide derivatives. To Reference |
Ref 9 | J Med Chem. 2008 Mar 27;51(6):1945-53. Epub 2008 Feb 29.Inhibition of carbonic anhydrases with glycosyltriazole benzene sulfonamides. To Reference |
Ref 10 | Bioorg Med Chem Lett. 2010 Nov 1;20(21):6208-12. Epub 2010 Aug 26.Paraoxon, 4-nitrophenyl phosphate and acetate are substrates of ¦Á- but not of ¦Â-, ¦Ã- and ¦Æ-carbonic anhydrases. To Reference |
Ref 11 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5775-80.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides derived from 4-isothiocyanato-benzolamide. To Reference |
Ref 12 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5769-73.Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions. To Reference |
Ref 13 | Nat Chem Biol. 2009 May;5(5):341-3. Epub 2009 Mar 29.Ligand-directed tosyl chemistry for protein labeling in vivo. To Reference |
Ref 14 | Bioorg Med Chem. 2009 Jul 15;17(14):5054-8. Epub 2009 May 30.Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. To Reference |
Ref 15 | Bioorg Med Chem Lett. 2004 Nov 1;14(21):5435-9.Carbonic anhydrase inhibitors. Inhibition of the newly isolated murine isozyme XIII with anions. To Reference |
Ref 16 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7255-8. Epub 2010 Oct 25.7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and XII over the cytosolic ones I and II in the low nanomolar/subnanomolar range. To Reference |
Ref 17 | Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies. To Reference |
Ref 18 | Bioorg Med Chem Lett. 2004 Sep 6;14(17):4563-7.Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions. To Reference |
Ref 19 | Bioorg Med Chem Lett. 2009 Apr 1;19(7):1855-7. Epub 2009 Feb 26.Carbonic anhydrase inhibitors. Inhibition of cytosolic isoforms I, II, III, VII and XIII with less investigated inorganic anions. To Reference |
Ref 20 | Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. To Reference |
Ref 21 | Bioorg Med Chem Lett. 2005 Dec 1;15(23):5192-6. Epub 2005 Oct 3.Carbonic anhydrase inhibitors: inhibition of the human isozymes I, II, VA, and IX with a library of substituted difluoromethanesulfonamides. To Reference |
Ref 22 | Eur J Med Chem. 2010 Sep;45(9):3656-61. Epub 2010 May 12.Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the human cytosolic isozymes I and II and transmembrane cancer-associated isozymes IX and XII. To Reference |
Ref 23 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5781-6.Carbonic anhydrase inhibitors. Design of anticonvulsant sulfonamides incorporating indane moieties. To Reference |
Ref 24 | J Med Chem. 2006 Nov 2;49(22):6539-48.A novel class of carbonic anhydrase inhibitors: glycoconjugate benzene sulfonamides prepared by "click-tailing". To Reference |
Ref 25 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. Epub 2010 Apr 28.Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mammalian isoforms I-XV. To Reference |
Ref 26 | Carbonic anhydrase inhibitors: inhibition of isozymes I, II and IV with N-hydroxysulfonamides--a novel class of intraocular pressure lowering agents. J Enzyme Inhib. 1998 Jul;13(4):267-84. To Reference |
Ref 27 | Inhibition of carbonic anhydrases I and II by N-unsubstituted carbamate esters. J Biol Chem. 1992 Dec 15;267(35):25044-50. To Reference |
Ref 28 | J Med Chem. 2008 Jun 12;51(11):3051-6. Epub 2008 Mar 19.Recent developments of carbonic anhydrase inhibitors as potential anticancer drugs. To Reference |
Ref 29 | Bioorg Med Chem. 2010 Aug 1;18(15):5498-503. Epub 2010 Jun 22.Mutation of Phe91 to Asn in human carbonic anhydrase I unexpectedly enhanced both catalytic activity and affinity for sulfonamide inhibitors. To Reference |
Ref 30 | Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. To Reference |
Ref 31 | Sulfenamido-sulfonamides as inhibitors of carbonic anhydrase isozymes I, II and IV. J Enzyme Inhib. 1997 Aug;12(3):175-90. To Reference |
Ref 32 | Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7.Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowering activity in a rabbit model of glaucoma. To Reference |
Ref 33 | Bioorg Med Chem Lett. 2005 Apr 1;15(7):1909-13.Carbonic anhydrase inhibitors. Inhibition of isozymes I, II, IV, V and IX with complex fluorides, chlorides and cyanides. To Reference |
Ref 34 | J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. To Reference |
Ref 35 | J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. To Reference |
Ref 36 | Bioorg Med Chem Lett. 2005 Jun 15;15(12):3096-101.Carbonic anhydrase inhibitors. Inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with Schiff's bases incorporating chromone and aromatic sulfonamide moieties, and their zinc complexes. To Reference |