Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDR01437

Target Information
NamemRNA of Protein tyrosine phosphatase-1B    
Type of targetResearch target    
SynonymsmRNA of PTP-1B    
mRNA of PTPN1    
mRNA of Protein-tyrosine phosphatase 1B    
mRNA of Tyrosine-protein phosphatase non-receptor type 1    
DiseaseType 2 Diabetes
[ICD9: 250.00, 250.02   ICD10: E11]
[1]
Drug(s)ISIS-PTP1BPreclinicalType 2 Diabetes[1]
UniProt IDP18031
PDB Structure1A5Y; 1AAX; 1BZC; 1BZH; 1BZJ; 1C83; 1C84; 1C85; 1C86; 1C87; 1C88; 1ECV; 1EEN; 1EEO; 1G1F; 1G1G; 1G1H; 1G7F; 1G7G; 1GFY; 1I57; 1JF7; 1KAK; 1KAV; 1L8G; 1LQF; 1NL9; 1NNY; 1NO6; 1NWE; 1NWL; 1NZ7; 1OEM; 1OEO; 1OES; 1OET; 1OEU; 1OEV; 1ONY; 1ONZ; 1PA1; 1PH0; 1PTT; 1PTU; 1PTV; 1PTY; 1PXH; 1PYN; 1Q1M; 1Q6J; 1Q6M; 1Q6N; 1Q6P; 1Q6S; 1Q6T; 1QXK; 1SUG; 1T48; 1T49; 1T4J; 1WAX; 1XBO; 2AZR; 2B07; 2B4S; 2BGD; 2BGE; 2CM2; 2CM3; 2CM7; 2CM8; 2CMA; 2CMB; 2CMC; 2CNE; 2CNF; 2CNG; 2CNH; 2CNI; 2F6F; 2F6T; 2F6V; 2F6W; 2F6Y; 2F6Z; 2F70; 2F71; 2FJM; 2FJN; 2H4G; 2H4K; 2HB1; 2HNP; 2HNQ; 2NT7; 2NTA; 2QBP; 2QBQ; 2QBR; 2QBS; 2VEU; 2VEV; 2VEW; 2VEX; 2VEY; 2ZMM; 2ZN7; 3A5J; 3A5K; 3CWE; 3D9C; 3EAX; 3EB1; 3EU0; 3I7Z; 3I80; 3QKP; 3QKQ; 3SME; 3ZV2; 4I8N.    
FunctionMay play an important role in CKII- and p60c-src-induced signal transduction cascades (By similarity).    
SequenceMEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT AGAYLCYRFLFNSNT
Target ValidationClick to Find Target Validation Information.    
Inhibitor1,2,3,4,6-penta-O-galloyl-D-glucopyranose[2]
1,2-NAPHTHOQUINONE[3]
16-alphaH,17-isovaleryloxy-ent-kauran-19-oic acid[4]
18alpha-Glycyrrhetic acid[5]
18beta-Glycyrrhetic acid[5]
19alpha,24-dihydroxyurs-12-en-3-on-28-oic acid[6]
24-hydroxyursolic acid[6]
3,9-Dihydroxy-4-prenyl-[6aR,   11aR]pterocarpan[7]
3- (4,5-Bis-biphenyl-4-yl-1H-imidazol-2-yl)-phenol[8]
3-epi-masilinic acid[9]
3-isopropyl-4- (phenylthio)naphthalene-1,2-dione[10]
3-oxoolean-12-en-27-oic acid[5]
3alpha,24-dihydroxyolean-12-en-27-oic acid[5]
3beta,6beta-dihydroxyolean-12-en-27-oic acid[5]
3beta-acetoxyolean-12-en-27-oic acid[5]
3beta-hydroxyolean-12-en-27-oic acid[5]
3beta-hydroxyurs-12-en-27-oic acid[5]
4'- ([11]
4'- (2-butylbenzofuran-3-yl)biphenyl-4-ol[11]
4- (p-toluidino)-3-isopropylnaphthalene-1,2-dione[10]
5-deoxyabyssinin II[12]
ALBAFURAN A[13]
BURTTINONE[14]
CAULERPIN[15]
CHROMOTROPATE[16]
DYSIDINE[17]
ERTIPROTAFIB[18]
ERYBREADIN B[7]
ERYTHRIBYSSIN A[7]
EVANS BLUE[16]
Erybreadin C[7]
Erybreadin D[7]
Erysubin E[7]
FOLITENOL[7]
FORMYLCHROMONE[19]
Kuwanon L[20]
LICOAGROCHACONE A[21]
LICOAGROCHALCONE A[12]
MASLINIC ACID[9]
Mulberrofuran C[20]
NEORAUTENOL[7]
OHIOENSIN A[22]
OLEANOLIC_ACID[23]
PHELLIGRIDIN I[24]
RK-682[25]
SIGMOIDIN A[12]
SIGMOIDIN B[12]
Sanggenon C[20]
Sanggenon G[20]
TRYPAN BLUE[16]
URSOLIC ACID[7]
USIMINE A[26]
USNIC ACID[26]
UVAOL[6]
abyssinin I[12]
abyssinin II[12]
abyssinoflavanone VI[12]
abyssinoflavanone VII[12]
abyssinone-IV[27]
abyssinone-VI-4-O-methyl ether[27]
augustic acid[9]
isochroman mono-carboxylic acid[19]
isoxazolecarboxylic acid[19]
kuwanon J[13]
kuwanon R[13]
kuwanon V[13]
methyl 3beta-hydroxyolean-12-en-28-oate[5]
methyl3beta-hydroxyolean-12-en-27-oate[5]
mulberrofuran D[13]
mulberrofuran W[13]
ohioensin C[22]
ohioensin F[22]
ohioensin G[22]
oleanonic acid[6]
oxalylaminobenzoic acid[19]
pomolic acid[6]
rotungenic acid[6]
sigmoidin F[12]
spathodic acid[6]
AntisenseISIS-PTP1B[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 12011 Pipeline of ISIS Pharm. To Reference
Ref 2J Nat Prod. 2010 Sep 24;73(9):1578-81.Bioactivity-guided isolation of 1,2,3,4,6-Penta-O-galloyl-D-glucopyranose from Paeonia lactiflora roots as a PTP1B inhibitor. To Reference
Ref 3Bioorg Med Chem Lett. 2002 Aug 5;12(15):1941-6.Synthesis and PTP1B inhibition of 1,2-naphthoquinone derivatives as potent anti-diabetic agents. To Reference
Ref 4Bioorg Med Chem Lett. 2006 Jun 1;16(11):3061-4. Epub 2006 Mar 20.Inhibition of protein tyrosine phosphatase 1B by diterpenoids isolated from Acanthopanax koreanum. To Reference
Ref 5Bioorg Med Chem Lett. 2006 Jun 15;16(12):3273-6. Epub 2006 Mar 31.Protein tyrosine phosphatase 1B inhibitory activity of triterpenes isolated from Astilbe koreana. To Reference
Ref 6J Nat Prod. 2008 Oct;71(10):1775-8. Epub 2008 Sep 18.Triterpenoids from the leaves of Diospyros kaki (persimmon) and their inhibitory effects on protein tyrosine phosphatase 1B. To Reference
Ref 7Bioorg Med Chem Lett. 2009 Dec 1;19(23):6745-9. Epub 2009 Oct 1.Cytotoxic and PTP1B inhibitory activities from Erythrina abyssinica. To Reference
Ref 8J Med Chem. 2002 May 23;45(11):2213-21.Molecular docking and high-throughput screening for novel inhibitors of protein tyrosine phosphatase-1B. To Reference
Ref 9Bioorg Med Chem Lett. 2009 Dec 1;19(23):6618-22. Epub 2009 Oct 8.Synthesis and biological evaluation of heterocyclic ring-substituted maslinic acid derivatives as novel inhibitors of protein tyrosine phosphatase 1B. To Reference
Ref 10Bioorg Med Chem Lett. 2006 Apr 1;16(7):1905-8. Epub 2006 Jan 24.Synthesis of miltirone analogues as inhibitors of Cdc25 phosphatases. To Reference
Ref 11Bioorg Med Chem. 2009 Apr 1;17(7):2658-72. Epub 2009 Mar 5.Synthesis, activity and molecular modeling of a new series of chromones as low molecular weight protein tyrosine phosphatase inhibitors. To Reference
Ref 12J Nat Prod. 2007 Jun;70(6):1039-42. Epub 2007 May 10.Isoprenylated flavonoids from the stem bark of Erythrina abyssinica. To Reference
Ref 13Bioorg Med Chem Lett. 2009 Dec 1;19(23):6759-61. Epub 2009 Oct 7.Protein tyrosine phosphatase 1B inhibitors isolated from Morus bombycis. To Reference
Ref 14Bioorg Med Chem. 2008 Dec 15;16(24):10356-62. Epub 2008 Oct 10.Flavanones from the stem bark of Erythrina abyssinica. To Reference
Ref 15Bioorg Med Chem Lett. 2006 Jun 1;16(11):2947-50. Epub 2006 Mar 24.Two novel aromatic valerenane-type sesquiterpenes from the Chinese green alga Caulerpa taxifolia. To Reference
Ref 16Bioorg Med Chem Lett. 2004 Apr 19;14(8):1923-6.Evans Blue and other dyes as protein tyrosine phosphatase inhibitors. To Reference
Ref 17Bioorg Med Chem Lett. 2009 Jan 15;19(2):390-2. Epub 2008 Nov 24.A novel sesquiterpene quinone from Hainan sponge Dysidea villosa. To Reference
Ref 18Bioorg Med Chem Lett. 2007 Oct 1;17(19):5357-60. Epub 2007 Aug 15.2-O-carboxymethylpyrogallol derivatives as PTP1B inhibitors with antihyperglycemic activity. To Reference
Ref 19Eur J Med Chem. 2010 Sep;45(9):3709-18. Epub 2010 May 15.Synthesis and evaluation of some novel dibenzo[b,d]furan carboxylic acids as potential anti-diabetic agents. To Reference
Ref 20Bioorg Med Chem Lett. 2006 Mar 1;16(5):1426-9. Epub 2005 Dec 13.Protein tyrosine phosphatase 1B inhibitors from Morus root bark. To Reference
Ref 21Bioorg Med Chem Lett. 2009 Sep 1;19(17):5155-7. Epub 2009 Jul 24.Inhibitory effect of chalcones and their derivatives from Glycyrrhiza inflata on protein tyrosine phosphatase 1B. To Reference
Ref 22Bioorg Med Chem Lett. 2008 Jan 15;18(2):772-5. Epub 2007 Nov 17.Ohioensins F and G: protein tyrosine phosphatase 1B inhibitory benzonaphthoxanthenones from the Antarctic moss Polytrichastrum alpinum. To Reference
Ref 23J Nat Prod. 2009 Sep;72(9):1620-6.Chemical Constituents of the Roots of Euphorbia micractina. To Reference
Ref 24J Nat Prod. 2007 Feb;70(2):296-9. Epub 2007 Feb 6.Structures, biogenesis, and biological activities of pyrano[4,3-c]isochromen-4-one derivatives from the Fungus Phellinus igniarius. To Reference
Ref 25Bioorg Med Chem Lett. 2010 Sep 15;20(18):5398-401. Epub 2010 Aug 1.Prenylflavonoids from Glycyrrhiza uralensis and their protein tyrosine phosphatase-1B inhibitory activities. To Reference
Ref 26J Nat Prod. 2008 Apr;71(4):710-2. Epub 2008 Feb 21.Usimines A-C, bioactive usnic acid derivatives from the Antarctic lichen Stereocaulon alpinum. To Reference
Ref 27J Nat Prod. 2006 Nov;69(11):1572-6.Protein tyrosine phosphatase-1B inhibitory activity of isoprenylated flavonoids isolated from Erythrina mildbraedii. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543