Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00015

Target Information
NameD(1B) dopamine receptor    
Type of targetSuccessful target    
SynonymsD(5) dopamine receptor    
D(5)D(1B) dopamine receptor dopamine receptor    
D1beta dopamine receptor    
Dopamine receptor 5    
DiseaseRespiratory diseases[1]
Drug(s)ApomorphineApprovedParkinson's Disease[2][3]
GMC-283No development reportedSchizophrenia[4]
ZD-3638No development reportedSchizophrenia[4]
LE-300PreclinicalSchizophrenia[4]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayCalcium signaling pathway
Neuroactive ligand-receptor interaction
UniProt IDP21918
FunctionThis is one of the five types (D1 to D5) of receptors for dopamine, and the activity of this receptor is mediated by g proteins which activate adenylyl cyclase.    
SequenceMLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Target ValidationClick to Find Target Validation Information.    
Inhibitor (+/-)-nantenine[5]
1- (4-[6]
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine[7]
1-[2- (2-Benzyl-phenoxy)-ethyl]-piperidine[8]
1-[2- (2-Benzyl-phenoxy)-ethyl]-pyrrolidine[8]
1-[3- (2-Benzyl-phenoxy)-propyl]-pyrrolidine[8]
3- (1-Propyl-piperidin-3-yl)-phenol[9]
4-[2- (2-Benzyl-phenoxy)-ethyl]-morpholine[8]
DIHYDREXIDINE[10]
FLUMEZAPINE[11]
FLUTROLINE[12]
ISOCLOZAPINE[7]
ISOLOXAPINE[13]
LE 300[14]
Phenyltoloxamine[8]
STEPHOLIDINE[10]
AgonistApomorphine[2][3]
SKF 38393[1]
AntagonistGMC-283[4]
LE-300[4]
BinderZD-3638[4]
MultitargetGMC-283[4]
ZD-3638[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Effect of dopamine receptor agonists on sensory nerve activity: possible therapeutic targets for the treatment of asthma and COPD. Br J Pharmacol. 2002 Jun;136(4):620-8. To Reference
Ref 2Investigation of a dopamine receptor in Schistosoma mansoni: Functional studies and immunolocalization. Mol Biochem Parasitol. 2009 Jun 21. [Epub ahead of print] To Reference
Ref 3Dopamine D1 receptor agonists induce penile erections in rats. Eur J Pharmacol. 2003 Jan 26;460(1):71-4. To Reference
Ref 4The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. To Reference
Ref 5Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. To Reference
Ref 6Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. Epub 2007 Jun 7.Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. To Reference
Ref 7J Med Chem. 1982 Jul;25(7):855-8.Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. To Reference
Ref 8J Med Chem. 2004 Aug 12;47(17):4155-8.Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 receptor selectivity. To Reference
Ref 9J Med Chem. 1988 Aug;31(8):1621-5.Dopamine autoreceptor agonists as potential antipsychotics. 1. (Aminoalkoxy)anilines. To Reference
Ref 10Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. Epub 2009 Aug 20.Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities? To Reference
Ref 11J Med Chem. 1982 Oct;25(10):1133-40.Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems. To Reference
Ref 12J Med Chem. 1980 Jun;23(6):635-43.Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. To Reference
Ref 13J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. To Reference
Ref 14Bioorg Med Chem Lett. 2007 Mar 1;17(5):1399-402. Epub 2006 Dec 3.Dopamine/serotonin receptor ligands. Part 15: Oxygenation of the benz-indolo-azecine LE 300 leads to novel subnanomolar dopamine D1/D5 antagonists. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543