Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00092

Target Information
NameAdenosine deaminase    
Type of targetSuccessful target    
SynonymsAdenosine aminohydrolase    
DiseaseAcute myeloid leukemia
[ICD9: 205.0   ICD10: C92.0]
[1]
Chronic lymphocytic leukemia
[ICD9: 204.1   ICD10: C91.1]
[1]
Chronic myeloid leukemia
[ICD9: 205.1   ICD10: C92.1]
[1]
Hairy-cell leukemia
[ICD9: 208.9   ICD10: C91-C95]
[1]
Non-Hodgkin's lymphoma, unspecified type
[ICD9: 200, 202, 202.8   ICD10: C81-C96, C82-C85]
[1]
Peripheral and cutaneous T-cell lymphomas
[ICD9: 202.1, 202.2, 202.8   ICD10: C81-C96, C84.0, C84.1]
[1]
Drug(s)CladribineApprovedHairy cell leukemia[2][1]
DipyridamoleApprovedHypertension[3][4]
FludarabineApprovedHematological malignancies[5]
PentostatinApprovedHairy cell leukemia[5][6]
BioChemical ClassHydrolases acting on carbon-nitrogen bonds    
EC NumberEC 3.5.4.4
PathwayMetabolic pathways
Primary immunodeficiency
Purine metabolism
UniProt IDP00813
PDB Structure1M7M; 3IAR.    
SequenceMAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPD FLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA EGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAI DLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGY HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIF KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAG QNL
Target ValidationClick to Find Target Validation Information.    
Inhibitor (2S,3R)-3-[7]
1-Deaza-Adenosine[8]
3- (6-Amino-purin-9-yl)-4-butoxy-butan-2-ol[9]
3- (6-Amino-purin-9-yl)-4-p-tolyl-butan-2-ol[9]
3- (6-Amino-purin-9-yl)-4-phenethyloxy-butan-2-ol[9]
3- (6-Amino-purin-9-yl)-5-m-tolyl-pentan-2-ol[9]
3- (6-Amino-purin-9-yl)-6-o-tolyl-hexan-2-ol[9]
3- (6-Amino-purin-9-yl)-6-phenyl-hexan-2-ol[9]
3- (6-Amino-purin-9-yl)-7-phenyl-heptan-2-ol[9]
3- (6-Amino-purin-9-yl)-8-phenyl-octan-2-ol[9]
3- (6-Amino-purin-9-yl)-non-5-en-2-ol[9]
3- (6-Amino-purin-9-yl)-non-5-en-2-ol[9]
3- (6-Amino-purin-9-yl)-non-5-yn-2-ol[9]
6-Hydroxy-1,6-Dihydro Purine Nucleoside[8]
6-Hydroxy-7,8-Dihydro Purine Nucleoside[8]
Cladribine[2][1]
Dipyridamole[3][4]
FR117016[7]
FR221647[7]
FR230513[7]
FR233623[7]
FR236913[7]
FR239087[7]
Fludarabine[5]
Pentostatin[5][6]
Purine Riboside[8]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Cladribine. Ortho Biotech Inc. Curr Opin Investig Drugs. 2001 Dec;2(12):1751-6. To Reference
Ref 2Cladribine: from the bench to the bedside--focus on hairy cell leukemia. Expert Rev Anticancer Ther. 2004 Oct;4(5):745-57. To Reference
Ref 3Beta-blockers and coronary flow reserve: the importance of a vasodilatory action. Drugs. 2008;68(5):579-90. To Reference
Ref 4Effects of dipyridamole, soluflazine and related molecules on adenosine uptake and metabolism by isolated human red blood cells. Fundam Clin Pharmacol. 1994;8(5):446-52. To Reference
Ref 5Purine nucleoside analogs in indolent non-Hodgkin's lymphoma. Oncology (Williston Park). 2000 Jun;14(6 Suppl 2):13-5. To Reference
Ref 6Acquisition of resistance to anticancer agents by overproduction of target enzymes. Nippon Rinsho. 1997 May;55(5):1030-7. To Reference
Ref 7Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 8Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 9J Med Chem. 2000 Nov 30;43(24):4694-700.Adenosine deaminase inhibitors: synthesis and biological evaluation of unsaturated, aromatic, and oxo derivatives of (+)-erythro-9-(2'S-hydroxy-3'R-nonyl)adenine [(+)-EHNA]. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543