Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00140

Target Information
NameAcetylcholinesterase    
Type of targetSuccessful target    
SynonymsAChE    
DiseaseAlzheimer's disease
[ICD9: 331.0   ICD10: G30]
[1]
Cognitive deficits
[ICD9: 290-294, 294.0, 780.09, 780.9, 780.93   ICD10: F01-F07, F04, R41.3]
[2]
Hypoxic-ischemic encephalopathy[3]
Motor neurone disease
[ICD9: 335.20   ICD10: G12.2]
[4]
Parkinson's disease
[ICD9: 332   ICD10: F02.3, G20]
[4]
Drug(s)AmbenoniumApprovedMyasthenia gravis[5]
Demecarium bromideApprovedOpen-angle glaucoma[6][7]
DonepezilApprovedAlzheimer's disease[8][9][10][1]
EdrophoniumApprovedDiagnosis of myasthenia gravis[11][12][13]
GalantamineApprovedAlzheimer's disease[8][14][15]
IsoflurophateApprovedGlaucoma[16]
MalathionApprovedPediculus humanus capitis[17]
NeostigmineApprovedMyasthenia gravis[11][12]
PhysostigmineApprovedGlaucoma[15][18]
PyridostigmineApprovedMyasthenia gravis[12]
RivastigmineApprovedAlzheimer's Disease[8]
TacrineApprovedAlzheimer's disease[19]
YM443ApprovedPostprandial fullness, upper abdominal bloating, and early satiation associated with functional dyspepsia
BioChemical ClassHydrolases acting on ester bonds    
EC NumberEC 3.1.1.7
PathwayGlycerophospholipid metabolism
UniProt IDP22303
PDB Structure1B41; 1F8U; 1PUV; 1PUW; 1VZJ; 2CLJ; 2X8B; 3LII; 4BDT; 4EY4; 4EY5; 4EY6; 4EY7; 4EY8.    
FunctionRapidly hydrolyzes choline released into the synapse.    
SequenceMRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN QFDHYSKQDRCSDL
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
Inhibitor (+/-)-huprineY hydrochloride[20]
(-)-Cymserine[21]
(-)-HUPERZINE B[22]
(-)-Phenserine[21]
(-)-Tolserine[21]
(-)-huperzine B[23]
(R)-tacrine[24]
(RS)-tacrine[23]
(S)-tacrine[24]
(S,S)-[23]
(S,S)-[23]
10-Hydroxy-infractopicrin[25]
7-methoxytacrine[26]
AP-2238[27]
AP-2243[28]
Ambenonium[5]
BENZOQUINONE[29]
BIS (12)-HUPERZINE B[22]
BIS (16)-HUPERZINE B[22]
BIS (18)-HUPERZINE B[22]
BIS (20)-HUPERZINE B[22]
BIS (8)-HUPERZINE B[22]
BIS (9)-HUPERZINE B[22]
BW-28C51[30]
BW-28C51[31]
Bis (14)-Huperzine B[22]
Bis (14)-Huperzine B[22]
Bis-7-tacrine[32]
But-3-enyl-trimethyl-ammonium,   bromide[33]
CAPROCTAMINE[34]
CHF-2819[35]
CHLORANIL[29]
CHLORPYRIFOS[36]
CHOLINE IODIDE[33]
CLEBOPRIDE[37]
CORONARIDINE[38]
CRYPTADINE B[39]
Caproctamine HCl[40]
Chlorphrifos oxon[41]
DECIDIUM[23]
Demecarium bromide[6][7]
Donepezil[8][9][10][1]
EDROPHONIUM BROMIDE[23]
ETHYLPHENSERINE[42]
Edrophonium[11][12][13]
Ethyl octylfluorophosphonate[41]
Fucose[43]
GALANTAMINE HYDROBROMIDE[44]
GALLAMINE[23]
GANSTIGMINE[23]
GENESERINE[35]
Galantamine[8][14][15]
HALOXYSTEROL A[45]
HALOXYSTEROL B[45]
HEPTYPHYSOSTIGMINE[42]
Hexyl-trimethyl-ammonium,   iodide[33]
Huperaine A[24]
Huperzine A[3]
Huperzine A[46]
Huprine Y[47]
Huprine-Tacrine Heterodimer[48]
INFRACTOPICRIN[25]
Icopezil maleate[49]
Isoflurophate[16]
Isopropyl dodecylfluorophosphonate[41]
Isosorbide-2-benzylcarbamate-5-tosylate[30]
Isosorbide-di- (4-nitrophenyl carbamate)[50]
Isosorbide-di- (benzylcarbamate)[50]
Isosorbide-di- (ethylcarbamate)[50]
Isosorbide-di-phenylcarbamate[50]
LAWSARITOL[45]
LIPOCRINE[51]
LYSICAMINE[52]
MEMOQUIN[51]
MESUAGENIN A[53]
MESUAGENIN B[53]
MF268[24]
Malathion[17]
Mesuagenin D[53]
Methyl Phosphinic Acid[43]
Methylphosphonic Acid Ester Group[43]
Monoisopropylphosphorylserine[43]
N- (14-methylallyl)norgalanthamine[54]
N-ALLYLNORGALANTHAMINE[54]
N-allylnorlitebamine[55]
N-benzylnorlitebamine[55]
N-butylnorlitebamine[55]
N-isobutylnorlitebamine[55]
N-isopropylnorlitebamine[55]
N-isopropylnorlitebamineN-methoiodide[55]
N-propylnorlitebamine[55]
NSC-23180[56]
Neostigmine[11][12]
OBIDOXIME[36]
PARAOXON[41]
PHENSERINE[57]
Petrosamine[58]
Physostigmine[15][18]
Physostigmine salicylate[59]
Propidium[43]
Pyridostigmine[12]
Pyridostigmine bromide[12]
QUILOSTIGMINE[42]
RIVASTIGMINE TARTRATE[35]
Rivastigmine[8]
TACRINE (8)-4-AMINOQUINOLINE[24]
TASPINE[60]
TERRITREM B[61]
THIOCTIC ACID[62]
TOLSERINE[42]
TRIMEDOXIME[36]
TURBINATINE[63]
Tacrine[19]
Tetraethylene Glycol[43]
Trimethyl- (3-nitro-phenyl)-ammonium,   iodide[33]
Trimethyl- (4-oxo-pentyl)-ammonium,   iodide[33]
VELNACRINE[64]
VOACANGINE[38]
XANTHOSTIGMINE[65]
beta-L-fucose[66]
carinatumins B (2)[67]
galanthamine derivative[23]
haloxysterol C[45]
haloxysterol D[45]
huprine X[23]
iso-OMPA[30]
palmatine trifluoroacetate[52]
pseudocolumbamine trifluoroacetate[52]
pseudopalmatine trifluoroacetate[52]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Towards a high-affinity allosteric enhancer at muscarinic M1 receptors. J Mol Neurosci. 2002 Aug-Oct;19(1-2):123-7. To Reference
Ref 2Profile of acetylcholinesterase in brain areas of male and female rats of adult and old age. Life Sci. 2001 Feb 16;68(13):1545-55. To Reference
Ref 3Huperzine A attenuates cognitive deficits and brain injury in neonatal rats after hypoxia-ischemia. Brain Res. 2002 Sep 13;949(1-2):162-70. To Reference
Ref 4Parkinson's disease, Alzheimer's disease and motor neurone disease: identifying a common mechanism. Neuroscience. 2002;113(3):485-92. To Reference
Ref 5Alpha6-containing nicotinic acetylcholine receptors dominate the nicotine control of dopamine neurotransmission in nucleus accumbens. Neuropsychopharmacology. 2008 Aug;33(9):2158-66. Epub 2007 Nov 21. To Reference
Ref 6The effects of topical ocular application of 0.25% demecarium bromide on serum acetylcholinesterase levels in normal dogs. Vet Ophthalmol. 2003 Mar;6(1):23-5. To Reference
Ref 7Neuromuscular blocking agents and axial teratogenesis in the avian embryo. Can axial morphogenetic disorders by explained by pharmacological action upon muscle tissue? Teratology. 1981 Apr;23(2):259-71. To Reference
Ref 8From symptomatic to disease modifying therapy? Recent developments in the pharmacotherapy of Alzheimer's disease. Fortschr Neurol Psychiatr. 2009 Jun;77(6):326-33. Epub 2009 Jun 5. To Reference
Ref 9Effects of chronic donepezil treatment and cholinergic deafferentation on parietal pyramidal neuron morphology. J Alzheimers Dis. 2009 May;17(1):177-91. To Reference
Ref 10Effects of rivastigmine and donepezil on brain acetylcholine levels in acetylcholinesterase-deficient mice. J Pharm Pharm Sci. 2009;12(1):79-85. To Reference
Ref 11Screening of acetylcholinesterase inhibitors by CE after enzymatic reaction at capillary inlet. J Sep Sci. 2009 May;32(10):1748-56. To Reference
Ref 12Neuromuscular blockade, reversal agent use, and operating room time: retrospective analysis of US inpatient surgeries. Curr Med Res Opin. 2009 Apr;25(4):943-50. To Reference
Ref 13Stabilization of Torpedo californica acetylcholinesterase by reversible inhibitors. Biochemistry. 2009 Jan 27;48(3):563-74. To Reference
Ref 14Effects of cholinesterase inhibition on brain white matter volume in Alzheimer's disease. Neuroreport. 2009 Feb 18;20(3):285-8. To Reference
Ref 15Acetylcholinesterase inhibitors enhance cognitive functions in rats following hypobaric hypoxia. Behav Brain Res. 2009 Oct 12;203(1):1-14. Epub 2009 Mar 28. To Reference
Ref 16Rational design of alkylene-linked bis-pyridiniumaldoximes as improved acetylcholinesterase reactivators. Chem Biol. 2003 Jun;10(6):491-502. To Reference
Ref 17Acetylcholinesterase activity in Corbicula fluminea Mull., as a biomarker of organophosphate pesticide pollution in Pinacanauan River, Philippines. Environ Monit Assess. 2009 May 12. [Epub ahead of print] To Reference
Ref 18Phencyclidine-induced cognitive deficits in mice are ameliorated by subsequent subchronic administration of donepezil: role of sigma-1 receptors. Brain Res. 2009 Jul 7;1279:189-96. Epub 2009 May 9. To Reference
Ref 19Evidence that the clinical effects of cholinesterase inhibitors are related to potency and targeting of action. Int J Clin Pract Suppl. 2002 Jun;(127):6-19. To Reference
Ref 20J Med Chem. 2006 Nov 16;49(23):6833-40.Binding of 13-amidohuprines to acetylcholinesterase: exploring the ligand-induced conformational change of the gly117-gly118 peptide bond in the oxyanion hole. To Reference
Ref 21Bioorg. Med. Chem. 18(13):4687-4693 (2010) To Reference
Ref 22J Med Chem. 2005 Feb 10;48(3):655-7.Bis-huperzine B: highly potent and selective acetylcholinesterase inhibitors. To Reference
Ref 23J Med Chem. 2008 Jun 12;51(11):3154-70. Epub 2008 May 15.Exploiting protein fluctuations at the active-site gorge of human cholinesterases: further optimization of the design strategy to develop extremely potent inhibitors. To Reference
Ref 24Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 25Bioorg Med Chem. 2010 Mar 15;18(6):2173-7. Epub 2010 Feb 4.Acetylcholinesterase inhibitors from the toadstool Cortinarius infractus. To Reference
Ref 26Bioorg Med Chem Lett. 2010 Oct 15;20(20):6093-5. Epub 2010 Aug 16.Synthesis and in vitro evaluation of N-alkyl-7-methoxytacrine hydrochlorides as potential cholinesterase inhibitors in Alzheimer disease. To Reference
Ref 27Bioorg Med Chem. 2010 Mar 1;18(5):1749-60. Epub 2010 Feb 4.Targeting Alzheimer's disease: Novel indanone hybrids bearing a pharmacophoric fragment of AP2238. To Reference
Ref 28Bioorg Med Chem Lett. 2008 Jan 1;18(1):423-6. Epub 2007 Oct 4.Multi-target-directed coumarin derivatives: hAChE and BACE1 inhibitors as potential anti-Alzheimer compounds. To Reference
Ref 29J Med Chem. 2005 Apr 21;48(8):2906-15.Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases. To Reference
Ref 30J Med Chem. 2008 Oct 23;51(20):6400-9. Epub 2008 Sep 26.Isosorbide-2-carbamate esters: potent and selective butyrylcholinesterase inhibitors. To Reference
Ref 31Bioorg Med Chem. 2008 Aug 1;16(15):7450-6. Epub 2008 Jun 14.Homo- and hetero-bivalent edrophonium-like ammonium salts as highly potent, dual binding site AChE inhibitors. To Reference
Ref 32Bioorg Med Chem Lett. 2010 Jun 15;20(12):3606-9. Epub 2010 Apr 28.Design, synthesis and evaluation of 2,4-disubstituted pyrimidines as cholinesterase inhibitors. To Reference
Ref 33J Med Chem. 1996 Dec 20;39(26):5064-71.Structure-based alignment and comparative molecular field analysis of acetylcholinesterase inhibitors. To Reference
Ref 34J Med Chem. 2008 Nov 27;51(22):7308-12.Structure-activity relationships of acetylcholinesterase noncovalent inhibitors based on a polyamine backbone. 4. Further investigation on the inner spacer. To Reference
Ref 35J Med Chem. 2006 Aug 24;49(17):5051-8.Structural determinants of Torpedo californica acetylcholinesterase inhibition by the novel and orally active carbamate based anti-alzheimer drug ganstigmine (CHF-2819). To Reference
Ref 36Bioorg Med Chem Lett. 2006 Feb;16(3):622-7. Epub 2005 Nov 8.Synthesis of the novel series of bispyridinium compounds bearing (E)-but-2-ene linker and evaluation of their reactivation activity against chlorpyrifos-inhibited acetylcholinesterase. To Reference
Ref 37J Med Chem. 2004 Sep 23;47(20):4818-28.Efficient method for high-throughput virtual screening based on flexible docking: discovery of novel acetylcholinesterase inhibitors. To Reference
Ref 38Bioorg Med Chem Lett. 2010 Nov 1;20(21):6185-7. Epub 2010 Aug 31.Indole alkaloids from Ervatamia hainanensis with potent acetylcholinesterase inhibition activities. To Reference
Ref 39Bioorg Med Chem. 2007 Dec 15;15(24):7803-8. Epub 2007 Aug 28.Cryptadines A and B, novel C27N3-type pentacyclic alkaloids from Lycopodium cryptomerinum. To Reference
Ref 40J Med Chem. 2007 Oct 4;50(20):4882-97. Epub 2007 Sep 13.Novel class of quinone-bearing polyamines as multi-target-directed ligands to combat Alzheimer's disease. To Reference
Ref 41Nat Chem Biol. 2008 Jun;4(6):373-8. Epub 2008 Apr 27.Activation of the endocannabinoid system by organophosphorus nerve agents. To Reference
Ref 42J Med Chem. 2010 Sep 9;53(17):6490-505.Novel carbamates as orally active acetylcholinesterase inhibitors found to improve scopolamine-induced cognition impairment: pharmacophore-based virtual screening, synthesis, and pharmacology. To Reference
Ref 43Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 44Bioorg Med Chem Lett. 2010 Jun 1;20(11):3254-8. Epub 2010 Apr 18.Synthesis of 4-[(diethylamino)methyl]-phenol derivatives as novel cholinesterase inhibitors with selectivity towards butyrylcholinesterase. To Reference
Ref 45Bioorg Med Chem Lett. 2006 Feb;16(3):573-80. Epub 2005 Nov 7.Isolation and cholinesterase-inhibition studies of sterols from Haloxylon recurvum. To Reference
Ref 46Epilepsy Res. 2009 Jan;83(1):1-43. Epub 2008 Nov 12.Progress report on new antiepileptic drugs: a summary of the Ninth Eilat Conference (EILAT IX). To Reference
Ref 47Bioorg Med Chem. 2009 Jul 1;17(13):4523-36. Epub 2009 May 8.Synthesis and structure-activity relationship of Huprine derivatives as human acetylcholinesterase inhibitors. To Reference
Ref 48J Med Chem. 2005 Mar 24;48(6):1701-4.Synthesis and pharmacological evaluation of huprine-tacrine heterodimers: subnanomolar dual binding site acetylcholinesterase inhibitors. To Reference
Ref 49J Med Chem. 2004 Oct 21;47(22):5492-500.A docking score function for estimating ligand-protein interactions: application to acetylcholinesterase inhibition. To Reference
Ref 50Bioorg Med Chem. 2010 Feb;18(3):1045-53. Epub 2010 Jan 6.Isosorbide-based cholinesterase inhibitors; replacement of 5-ester groups leading to increased stability. To Reference
Ref 51J Med Chem. 2009 Dec 10;52(23):7883-6.Toward a rational design of multitarget-directed antioxidants: merging memoquin and lipoic acid molecular frameworks. To Reference
Ref 52J. Nat. Prod. 73(10):1632-1635 (2010) To Reference
Ref 53Bioorg Med Chem. 2010 Nov 15;18(22):7873-7. Epub 2010 Sep 25.4-Phenylcoumarins from Mesua elegans with acetylcholinesterase inhibitory activity. To Reference
Ref 54Bioorg Med Chem Lett. 2008 Apr 1;18(7):2263-6. Epub 2008 Mar 7.N-Alkylated galanthamine derivatives: Potent acetylcholinesterase inhibitors from Leucojum aestivum. To Reference
Ref 55J Nat Prod. 1998 Jan;61(1):46-50.Litebamine N-homologues: preparation and anti-acetylcholinesterase activity. To Reference
Ref 56J Med Chem. 2007 Nov 15;50(23):5727-34. Epub 2007 Oct 17.Planarity and constraint of the carbonyl groups in 1,2-diones are determinants for selective inhibition of human carboxylesterase 1. To Reference
Ref 57Bioorg Med Chem Lett. 2010 Mar 1;20(5):1532-4. Epub 2010 Jan 25.Synthesis of physostigmine analogues and evaluation of their anticholinesterase activities. To Reference
Ref 58Bioorg Med Chem. 2008 Jul 1;16(13):6560-7. Epub 2008 May 15.Petrosamine, a potent anticholinesterase pyridoacridine alkaloid from a Thai marine sponge Petrosia n. sp. To Reference
Ref 59Bioorg Med Chem. 2009 Oct 1;17(19):6937-41. Epub 2009 Aug 14.Rational design and synthesis of highly potent anti-acetylcholinesterase activity huperzine A derivatives. To Reference
Ref 60J Nat Prod. 2006 Sep;69(9):1341-6.Taspine: bioactivity-guided isolation and molecular ligand-target insight of a potent acetylcholinesterase inhibitor from Magnolia x soulangiana. To Reference
Ref 61J. Nat. Prod. 58(6):857-862 (1995) To Reference
Ref 62J Med Chem. 2008 Feb 14;51(3):347-72. Epub 2008 Jan 9.Multi-target-directed ligands to combat neurodegenerative diseases. To Reference
Ref 63J Nat Prod. 2004 Nov;67(11):1882-5.Indole glucoalkaloids from Chimarrhis turbinata and their evaluation as antioxidant agents and acetylcholinesterase inhibitors. To Reference
Ref 64Bioorg. Med. Chem. Lett. 2(8):865-870 (1992) To Reference
Ref 65J Med Chem. 1998 Oct 8;41(21):3976-86.Acetylcholinesterase inhibitors: synthesis and structure-activity relationships of omega-[N-methyl-N-(3-alkylcarbamoyloxyphenyl)- methyl]aminoalkoxyheteroaryl derivatives. To Reference
Ref 66Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference
Ref 67Bioorg Med Chem. 2007 Feb 15;15(4):1703-7. Epub 2006 Dec 15.Carinatumins A-C, new alkaloids from Lycopodium carinatum inhibiting acetylcholinesterase. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543