Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00167

Target Information
NameCalcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1    
Type of targetSuccessful target    
Synonyms61 kDa Cam-PDE    
Cam-PDE 1    
Cam-PDE 1A    
HCam-1    
PDE-I    
DiseaseCardiovascular disease, unspecified
[ICD9: 390-459   ICD10: I00-I99]
[1]
Erectile dysfunction
[ICD9: 302.72, 607.84   ICD10: F52.2, N48.4]
[2]
Drug(s)VinpocetineApprovedAcute ischaemic stroke[3]
BioChemical ClassHydrolases acting on ester bonds    
EC NumberEC 3.1.4.17
PathwayCalcium signaling pathway
Olfactory transduction
Purine metabolism
Taste transduction
UniProt IDP54750
Q01064
Q14123
PDB Structure1LXS.    
FunctionHas a higher affinity for cgmp than for camp.    
SequenceMGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ
Related US Patent6,362,178
6,566,360
Target ValidationClick to Find Target Validation Information.    
Inhibitor3-Isobutyl-1-methyl-3,7-dihydro-purine-2,6-dione[4]
BUFROLIN[4]
S,S- (2-Hydroxyethyl)Thiocysteine[5]
Vinpocetine[3]
ZAPRINAST[6]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Muscarinic receptor M1 and phosphodiesterase 1 are key determinants in pulmonary vascular dysfunction following perinatal hypoxia in mice. Am J Physiol Lung Cell Mol Physiol. 2008 Jul;295(1):L201-13. Epub 2008 May 9. To Reference
Ref 2Review of phosphodiesterases in the urogenital system: new directions for therapeutic intervention. J Sex Med. 2004 Nov;1(3):322-36. To Reference
Ref 3Effects of phosphodiesterase inhibitors on contraction induced by endothelin-1 of isolated human prostatic tissue. Urology. 2009 Jun;73(6):1397-401. Epub 2009 Mar 13. To Reference
Ref 4J Med Chem. 1985 May;28(5):537-45.A new generation of phosphodiesterase inhibitors: multiple molecular forms of phosphodiesterase and the potential for drug selectivity. To Reference
Ref 5Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 6J Med Chem. 2005 May 19;48(10):3449-62.The next generation of phosphodiesterase inhibitors: structural clues to ligand and substrate selectivity of phosphodiesterases. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543