Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00174

Target Information
NameNeuraminidase    
Type of targetSuccessful target    
SynonymsN-acylneuraminate glycohydrolase    
NANase    
STNA    
Sialidase    
DiseaseInfluenza, virus not identified
[ICD9: 487, 488   ICD10: J10, J11]
[1]
Drug(s)OseltamivirApprovedInfluenza virus infection[2][3]
ZanamivirApprovedInfluenza virus infection[2][3]
CS-8958Phase IIIInfluenza virus infection[4]
PeramivirPhase IIIInfluenza virus infection[4][2]
BioChemical ClassGlycosylases    
EC NumberEC 3.2.1.18
PathwayLysosome
Other glycan degradation
Sphingolipid metabolism
UniProt IDP06818
P29768
PDB Structure1DIL; 1DIM; 2SIL; 2SIM; 3SIL.    
FunctionCleaves the terminal sialic acid (n-acetyl neuraminic acid) from carbohydrate chains in glycoproteins providing free sialic acid which can be used as carbon and energy sources. Sialidases have been suggested to be pathogenic factors in microbial infection.    
SequenceMNPNQKIITIGSVSLTIATICFLMQIAILVTTVTLHFKQYECSSPPNNQVMPCEPIIIER NITEIVYLTNTTIDKEICPKLVEYRNWSKPQCKITGFAPFSKDNSIRLSAGGGIWVTREP YVSCDPGKCYQFALGQGTTLDNKHSNDTIHDRTPYRTLLMNELGVPFHLGTRQVCIAWSS SSCHDGKAWLHVCVTGYDKNATASFIYDGRLVDSIGSWSKNILRTQESECVCINGTCTVV MTDGSASERADTKILFIEEGKIVHISPLSGSAQHVEECSCYPRYPGVRCVCRDNWKGSNR PVVDINVKDYSIVSSYVCSGLVGDTPRKNDRSSSSYCRNPNNEKGNHGVKGWAFDDGNDV WMGRTISEESRSGYETFKVIGGWSTPNSKLQINRQVIVDSDNRSGYSGIFSVEGKSCINR CFYVELIRGREQETRVWWTSNSIVVFCGTSGTYGTGSWPDGADINLMPI
Related US Patent6,509,359
6,518,299
6,548,476
6,562,861
6,593,314
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
Inhibitor (E,E)-1,7-Diphenyl-4,6-heptadien-3-one[5]
(E,E)-5-Hydroxy-1,7-diphenyl-4,6-heptadien-3-one[5]
(S)-1,7-Diphenyl-6[5]
2,4-Deoxy-4-Guanidino-5-N-Acetyl-Neuraminic Acid[6]
2-Deoxy-2,3-Dehydro-N-Acetyl-Neuraminic Acid[7]
4- (ACETYLAMINO)-3-HYDROXY-5-NITROBENZOIC ACID[8]
4- (ACETYLAMINO)-5-AMINO-3-HYDROXYBENZOIC ACID[8]
4- (Acetylamino)-3-Amino Benzoic Acid[7]
4- (Acetylamino)-3-Guanidinobenzoic Acid[6]
4-Amino-2-Deoxy-2,3-Dehydro-N-Neuraminic Acid[6]
8-DEOXYGARTANIN[9]
A-192558[10][11][12]
A-315675[10][11][12]
APIGENIN[13]
Alpha-D-Mannose[7]
BCX-1812[10][11][12]
BCX-1827[10][11][12]
BCX-1898[10][11][12]
BCX-1923[10][11][12]
Bcx-1812[7]
Beta-D-Mannose[7]
Beta-Sialic Acid[7]
CALOPOCARPIN[14]
CS-8958[4]
CUDRATRICUSXANTHONE[15]
Cudratricusxanthone F[15]
Cudraxanthone D[15]
Cudraxanthone L[15]
Cudraxanthone M[15]
Cyclopentane amide derivatives 1[10][11][12]
Cyclopentane amide derivatives 2[10][11][12]
Cyclopentane amide derivatives 3[10][11][12]
Cyclopentane amide derivatives 4[10][11][12]
DANA[10][11][12]
DEMETHYLMEDICARPIN[14]
ERYSTAGALLIN A[14]
Erythribyssin D[14]
Erythribyssin L[14]
Erythribyssin M[14]
Erythribyssin O[14]
FANA[10][11][12]
Fucose[7]
GARCINONE D[9]
GARTANIN[9]
GOSSYPETIN[13]
GS4071[10][11][12]
HERBACETIN[13]
ISONEORAUTENOL[14]
KAEMPFEROL[13]
KATSUMADAIN A[5]
Lactose[7]
MACLURAXANTHONE[15]
MANGIFERIN[15]
MANGOSTANIN[9]
MANGOSTANOL[9]
MANGOSTENONE F[9]
MANGOSTENONE G[9]
MANGOSTIN[9]
NEORAUTENOL[14]
O-Sialic Acid[8]
OSELTAMIVIR ACID[16]
Oseltamivir[2][3]
PHASEOLIN[14]
PHASEOLLIDIN[14]
Peramivir[4][2]
RHODIOLININ[13]
SMEATHXANTHONE A[9]
Zanamivir[2][3]
cristacarpin[14]
erysubin D[14]
erysubin E[14]
eryvarin D[14]
gamma-mangostin[9]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1New millennium antivirals against pandemic and epidemic influenza: the neuraminidase inhibitors. Antivir Chem Chemother. 2002 Jul;13(4):205-17. To Reference
Ref 2Current and future antiviral therapy of severe seasonal and avian influenza. Antiviral Res. 2008 Apr;78(1):91-102. Epub 2008 Feb 4. To Reference
Ref 3Antiviral agents for influenza, hepatitis C and herpesvirus, enterovirus and rhinovirus infections. Med J Aust. 2001 Jul 16;175(2):112-6. To Reference
Ref 4Developing new antiviral agents for influenza treatment: what does the future hold? Clin Infect Dis. 2009 Jan 1;48 Suppl 1:S3-13. To Reference
Ref 5J Med Chem. 2010 Jan 28;53(2):778-86.Antiviral potential and molecular insight into neuraminidase inhibiting diarylheptanoids from Alpinia katsumadai. To Reference
Ref 6Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference
Ref 7Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 8Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 9Bioorg Med Chem. 2010 Sep 1;18(17):6258-64. Epub 2010 Jul 19.Xanthones with neuraminidase inhibitory activity from the seedcases of Garcinia mangostana. To Reference
Ref 10Antiviral agents active against influenza A viruses. Nat Rev Drug Discov. 2006 Dec;5(12):1015-25. To Reference
Ref 11Comparison of the anti-influenza virus activity of cyclopentane derivatives with oseltamivir and zanamivir in vivo. Bioorg Med Chem. 2005 Jun 2;13(12):4071-7. Epub 2005 Apr 25. To Reference
Ref 12Syntheses and neuraminidase inhibitory activity of multisubstituted cyclopentane amide derivatives. J Med Chem. 2004 Apr 8;47(8):1919-29. To Reference
Ref 13Bioorg Med Chem. 2009 Oct 1;17(19):6816-23. Epub 2009 Aug 21.Neuraminidase inhibitory activities of flavonols isolated from Rhodiola rosea roots and their in vitro anti-influenza viral activities. To Reference
Ref 14Bioorg Med Chem. 2010 May 1;18(9):3335-44. Epub 2010 Mar 9.Prenylated pterocarpans as bacterial neuraminidase inhibitors. To Reference
Ref 15Bioorg Med Chem. 2009 Apr 1;17(7):2744-50. Epub 2009 Feb 26.Characteristic of neuraminidase inhibitory xanthones from Cudrania tricuspidata. To Reference
Ref 16Antimicrob Agents Chemother. 2008 Oct;52(10):3484-91. Epub 2008 Aug 11.Limited inhibitory effects of oseltamivir and zanamivir on human sialidases. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543