Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00310

Target Information
NameDNA polymerase    
Type of targetSuccessful target    
DiseaseHepatitis B
[ICD9: 070.2, 070.3   ICD10: B16, B18.0, B18.1]
[1]
Herpes virus infection
[ICD9: 001-139, 042-075   ICD10: A00-B99, A80-A99, B00-B34]
[2]
Parasitic diseases[3]
Viral infection, unspecified
[ICD9: 001-139, 042-075   ICD10: A00-B99, A80-A99, B00-B34]
[4][5]
Drug(s)AciclovirApprovedVirus infections[5]
ChloroquiniumApprovedMalaria[6]
CidofovirApprovedCytomegalovirus (CMV) retinitis[7]
CytarabineApprovedHematological malignancies [8]
FoscavirApprovedCytomegalovirus retinitis[7]
GanciclovirApprovedVirus infections[9]
ValaciclovirApprovedVirus infections[10]
ValganciclovirApprovedVirus infections[7]
VidarabineApprovedHerpes simplex virus infection[11]
BioChemical ClassDNA-directed DNA polymerase    
EC NumberEC 2.7.7.7
UniProt IDO39644
SequenceMPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFT GLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLT KYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQELQ HGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS GSIRARVHPTTRRSFGVEPAGSGRTDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGH AVELHNIPPSSARPQSEGPILPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNI RIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTQVSWPKFAVPNLQSLTNLLS SNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNTNYQHRTMQDLHE SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRA FPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVI GCWGTLPQEHIVLKIKNCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYAC IQSKQAFTFSPTYKAFLRKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRVRGTFV APLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYV PSALNPADNPSRGRLGLYRPLLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAW KPP
Target ValidationClick to Find Target Validation Information.    
Inhibitor (+)-Myristinin A[12]
(+)-Myristinin D[12]
(24E)-3beta-hydroxy-7,24-euphadien-26-oic acid[13]
2'-deoxythymidine triphosphate[1]
3-Oximo-olean-12-en-29-oic acid[14]
3-cis-p-coumaroyl maslinic acid[15]
3-trans-p-coumaroyl maslinic acid[15]
3alpha-O-trans-p-coumaroyl-7-labden-15-oic acid[16]
3beta-hydroxyrus-12,19 (29)-dien-28-oic acid[17]
3beta-hydroxyrus-18,20 (30)-dien-28-oic acid[17]
5-propenyl-2'-deoxyuridine triphosphate[1]
5-propenyl-arabinofuranosyluracil 5'-triphosphate[1]
6- (3-Ethyl-phenylamino)-1H-pyrimidine-2,4-dione[18]
6- (4-Bromo-phenylamino)-1H-pyrimidine-2,4-dione[18]
6- (4-Chloro-phenylamino)-1H-pyrimidine-2,4-dione[18]
Aciclovir[5]
Actinomycin D[19]
Acyclovir[5]
BETULINIC ACID[15]
Chloroquinium[6]
Cidofovir[7]
Cytarabine[8]
EPICATECHIN[20]
Foscavir[7]
Ganciclovir[9]
Guanosine[21]
Guanosine-5'-Monophosphate[21]
Mahureone D[22]
OLEANOLIC_ACID[17]
PENICILLIOL A[23]
TALAROFLAVONE[24]
URSOLIC ACID[17]
Valaciclovir[10]
Valganciclovir[7]
Vidarabine[11]
ZIDOVUDINE TRIPHOSPHATE[25]
alpha,beta-methylene-dATP[26]
alpha,beta-methylene-dCTP[26]
alpha,beta-methylene-dGTP[26]
alpha,beta-methylene-dTTP[26]
ddCTP SODIUM[22]
gallic acid 5,6-dihydroxy-3-carboxyphenylester[27]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Inhibition of human hepatitis B virus DNA polymerase and duck hepatitis B virus DNA polymerase by triphosphates of thymidine analogs and pharmacokinetic properties of the corresponding nucleosides. J Med Virol. 1988 Dec;26(4):353-62. To Reference
Ref 2The herpesvirus encoded dUTPase as a potential chemotherapeutic target. Curr Protein Pept Sci. 2001 Dec;2(4):371-9. To Reference
Ref 3Scientific hypothesis: a new strategy for the design of anti-protozoal drugs--DNA polymerase as a drug target. Appl Parasitol. 1994 Sep;35(3):157-68. To Reference
Ref 4Structural and functional organization of herpes simplex virus DNA polymerase investigated by limited proteolysis. J Biol Chem. 1994 Sep 9;269(36):22788-96. To Reference
Ref 5Perspectives in antiviral chemotherapy. Fundam Clin Pharmacol. 1990;4(4):357-72. To Reference
Ref 6Simian malaria in a U.S. traveler--New York, 2008. MMWR Morb Mortal Wkly Rep. 2009 Mar 13;58(9):229-32. To Reference
Ref 7Drug targets in cytomegalovirus infection. Infect Disord Drug Targets. 2009 Apr;9(2):201-22. To Reference
Ref 8Chromatin-associated proteins HMGB1/2 and PDIA3 trigger cellular response to chemotherapy-induced DNA damage. Mol Cancer Ther. 2009 Apr;8(4):864-72. To Reference
Ref 9Application of real time polymerase chain reaction to the diagnosis and treatment of cytomegalovirus infection after allogeneic hematopoietic stem cell transplantation. Zhonghua Xue Ye Xue Za Zhi. 2009 Feb;30(2):77-81. To Reference
Ref 10Extensive oral shedding of human herpesvirus 8 in a renal allograft recipient. Oral Microbiol Immunol. 2009 Apr;24(2):109-15. To Reference
Ref 11Prognostic value of intrathecal antibody production and DNA viral load in cerebrospinal fluid of patients with herpes simplex encephalitis. J Neurol. 2009 Apr 8. [Epub ahead of print] To Reference
Ref 12J Nat Prod. 2005 Nov;68(11):1625-8.(+)-Myristinins A and D from Knema elegans, which inhibit DNA polymerase beta and cleave DNA. To Reference
Ref 13J Nat Prod. 2000 Oct;63(10):1356-60.A new 7,8-euphadien-type triterpenoid from Brackenridgea nitida and Bleasdalea bleasdalei that inhibits DNA polymerase beta. To Reference
Ref 14J Nat Prod. 1999 Aug;62(8):1110-3.DNA polymerase beta inhibitors from Sandoricum koetjape. To Reference
Ref 15J Nat Prod. 1999 Dec;62(12):1660-3.DNA polymerase beta inhibitors from Tetracera boiviniana. To Reference
Ref 16J Nat Prod. 1999 Jul;62(7):1000-2.Harbinatic acid, a novel and potent DNA polymerase beta inhibitor from Hardwickia binata. To Reference
Ref 17J Nat Prod. 1999 Dec;62(12):1624-6.DNA polymerase beta inhibitors from Baeckea gunniana. To Reference
Ref 18J Med Chem. 1980 Jan;23(1):34-8.Inhibitors of Bacillus subtilis DNA polymerase III. 6-Anilinouracils and 6-(alkylamino)uracils. To Reference
Ref 19Selective binding of actinomycin D and distamycin A to DNA. Nucleic Acids Res. 1982 Nov 25;10(22):7273-82. To Reference
Ref 20J Nat Prod. 2004 Oct;67(10):1744-7.DNA polymerase beta lyase inhibitors from Maytenus putterlickoides. To Reference
Ref 21Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 22J Nat Prod. 2005 Jul;68(7):979-84.Acylphloroglucinol derivatives from Mahurea palustris. To Reference
Ref 23Bioorg Med Chem. 2009 Mar 1;17(5):1811-6. Epub 2009 Feb 1.Penicilliols A and B, novel inhibitors specific to mammalian Y-family DNA polymerases. To Reference
Ref 24Bioorg Med Chem. 2008 Mar 15;16(6):2939-44. Epub 2007 Dec 25.1-deoxyrubralactone, a novel specific inhibitor of families X and Y of eukaryotic DNA polymerases from a fungal strain derived from sea algae. To Reference
Ref 25J Med Chem. 2005 Sep 8;48(18):5794-804.4-Oxo-4,7-dihydrothieno[2,3-b]pyridines as non-nucleoside inhibitors of human cytomegalovirus and related herpesvirus polymerases. To Reference
Ref 26J Med Chem. 2008 Oct 23;51(20):6460-70. Epub 2008 Sep 24.Alpha,beta-methylene-2'-deoxynucleoside 5'-triphosphates as noncleavable substrates for DNA polymerases: isolation, characterization, and stability studies of novel 2'-deoxycyclonucleosides, 3,5'-cyclo-dG, and 2,5'-cyclo-dT. To Reference
Ref 27J. Nat. Prod. 53(5):1234-1240 (1990) To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543