Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00341

Target Information
NameAmine oxidase [flavin-containing] B    
Type of targetSuccessful target    
SynonymsMAO-B    
Monoamine oxidase    
Monoamine oxidase B    
DiseaseMajor depressive disorder
[ICD9: 296.2, 296.3   ICD10: F32, F33]
[1]
Neurological diseases[2]
Parkinson's disease
[ICD9: 332   ICD10: F02.3, G20]
[3]
Drug(s)PargylineApprovedHypertension[4]
PhenelzineApprovedDepression[5]
RasagilineApprovedParkinson's disease[6]
SelegilineApprovedParkinson's disease[3][7][8]
TranylcypromineApprovedDepression[9][10]
SafinamidePhase III completedParkinson's Disease[11][12]
SafinamidePhase IIIIdiopathic Parkinson's Disease[11][12]
CHF-3381Phase IINeuropathic pain[13]
RG1577Phase IIAlzheimer's disease
PF9601NPhase IParkinson¡¯s Disease[14]
BioChemical ClassOxidoreductases acting on the CH-NH2 group of donors    
EC NumberEC 1.4.3.4
PathwayArginine and proline metabolism
Drug metabolism - cytochrome P450
Glycine, serine and threonine metabolism
Histidine metabolism
Metabolic pathways
Phenylalanine metabolism
Tryptophan metabolism
Tyrosine metabolism
UniProt IDP27338
PDB Structure1GOS; 1H8R; 1OJ9; 1OJA; 1OJC; 1OJD; 1S2Q; 1S2Y; 1S3B; 1S3E; 2BK3; 2BK4; 2BK5; 2BYB; 2C64; 2C65; 2C66; 2C67; 2C70; 2C72; 2C73; 2C75; 2C76; 2V5Z; 2V60; 2V61; 2VRL; 2VRM; 2VZ2; 2XCG; 2XFN; 2XFO; 2XFP; 2XFQ; 2XFU; 3PO7; 3ZYX; 4A79; 4A7A.    
FunctionCatalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. Mao-B preferentially degrades benzylamine.    
SequenceMSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Related US Patent6,432,991
6,569,470
6,635,667
Target ValidationClick to Find Target Validation Information.    
Inhibitor (E)-5-Styrylisatin[15]
(E)-6-Styrylisatin[15]
(R/R)BEFLOXATONE[16]
1H-Indole-2,3-dione[17]
2-BFi[18]
7-Methoxy-9H-beta-carboline[19]
8- (3-Bromobenzyloxy)caffeine[20]
8- (3-Chlorobenzyloxy)caffeine[20]
8- (3-Fluorobenzyloxy)caffeine[20]
8- (3-Methoxybenzyloxy)caffeine[20]
8- (3-Methylbenzyloxy)caffeine[20]
8-Benzyloxycaffeine[20]
8-[ (3-Trifluoromethyl)benzyloxy]caffeine[20]
AS-605240[21]
CGS-19281A[22]
CHALCONE[23]
CHF-3381[13]
CORDOIN[23]
Deprenyl[24]
Farnesol[25]
Flavin-Adenine Dinucleotide[26]
HYDRAZINECARBOXAMIDE[27]
Heptyl-methyl-prop-2-ynyl-amine,   hydrochloride[28]
IPRONIAZIDE[29]
Isatin[30]
Isopsoralen[31]
L-136662[21]
LAZEBEMIDE[17]
Lauryl Dimethylamine-N-Oxide[26]
MOFEGILINE[32]
Methyl piperate[33]
NSC-50187[34]
NSC-50393[34]
NSC-93405[34]
PF9601N[14]
PIPERINE[33]
PNU-22394[19]
Pargyline[4]
Phenelzine[5]
Psoralen[31]
RS-1636[35]
RS-1653[35]
Rasagiline[6]
Safinamide[11][12]
Selegiline[3][7][8]
TOLOXATONE[16]
TRACIZOLINE[36]
TRYPTAMINE[19]
TRYPTOLINE[36]
Tranylcypromine[9][10]
Zydis selegiline[12]
Antagonist4-Methoxyamphetamine[37]
MMDA[26]
MultitargetCHF-3381[13]
Tranylcypromine[9][10]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Recent developments in the psychobiology and pharmacotherapy of depression: optimising existing treatments and novel approaches for the future. Expert Opin Investig Drugs. 2003 Jan;12(1):65-86. To Reference
Ref 2Crystal structure of human monoamine oxidase B, a drug target enzyme monotopically inserted into the mitochondrial outer membrane. FEBS Lett. 2004 Apr 30;564(3):225-8. To Reference
Ref 3Neuroprotective actions of selegiline. J Neurosci Res. 2002 Feb 1;67(3):285-9. To Reference
Ref 4Dose-dependent activation of distinct hypertrophic pathways by serotonin in cardiac cells. Am J Physiol Heart Circ Physiol. 2009 Aug;297(2):H821-8. Epub 2009 Jun 19. To Reference
Ref 5Limitation of adipose tissue enlargement in rats chronically treated with semicarbazide-sensitive amine oxidase and monoamine oxidase inhibitors. Pharmacol Res. 2008 Jun;57(6):426-34. Epub 2008 Apr 24. To Reference
Ref 6Glyceraldehyde-3-Phosphate Dehydrogenase-Monoamine Oxidase B-Mediated Cell Death-Induced by Ethanol is Prevented by Rasagiline and 1-R-Aminoindan. Neurotox Res. 2009 Aug;16(2):148-59. Epub 2009 May 28. To Reference
Ref 7The role of the regulatory enzymes of catecholamine synthesis in Parkinson's disease. Neurology. 1992 Apr;42(4 Suppl 4):8-12; discussion 41-8. To Reference
Ref 8Monoamine oxidase inhibitors and their pharmacological significance. Acta Neurol Scand Suppl. 1983;95:37-41. To Reference
Ref 9Tranylcypromine: new perspectives on an "old" drug. Eur Arch Psychiatry Clin Neurosci. 2006 Aug;256(5):268-73. To Reference
Ref 10Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9. To Reference
Ref 11Emerging drugs for epilepsy. Expert Opin Emerg Drugs. 2007 Sep;12(3):407-22. To Reference
Ref 12Emerging drugs for Parkinson's disease. Expert Opin Emerg Drugs. 2006 Sep;11(3):403-17. To Reference
Ref 13Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. To Reference
Ref 14Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. To Reference
Ref 15Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13. Epub 2009 Mar 14.Inhibition of monoamine oxidase by (E)-styrylisatin analogues. To Reference
Ref 16J Med Chem. 2002 Mar 14;45(6):1180-3.3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A. To Reference
Ref 17Bioorg Med Chem Lett. 2005 Oct 15;15(20):4438-46.Docking studies on monoamine oxidase-B inhibitors: estimation of inhibition constants (K(i)) of a series of experimentally tested compounds. To Reference
Ref 18Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9. Epub 2008 Mar 6.Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors. To Reference
Ref 19Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002.Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation. To Reference
Ref 20Bioorg Med Chem. 2010 Feb;18(3):1018-28. Epub 2010 Jan 6.Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues. To Reference
Ref 21Bioorg Med Chem Lett. 2010 Sep 1;20(17):5295-8. Epub 2010 Jul 1.Identification of novel monoamine oxidase B inhibitors by structure-based virtual screening. To Reference
Ref 22Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. To Reference
Ref 23J Med Chem. 2009 May 14;52(9):2818-24.Chalcones: a valid scaffold for monoamine oxidases inhibitors. To Reference
Ref 24The effect of deprenyl washout in patients with long-standing Parkinson's disease. J Neural Transm. 2002 May;109(5-6):797-803. To Reference
Ref 25Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 26Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 27J Med Chem. 2004 Nov 18;47(24):5860-71.Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxidase. To Reference
Ref 28J Med Chem. 1992 Oct 2;35(20):3705-13.Aliphatic propargylamines: potent, selective, irreversible monoamine oxidase B inhibitors. To Reference
Ref 29Bioorg Med Chem. 2010 Feb 15;18(4):1659-64. Epub 2010 Jan 4.Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors. To Reference
Ref 30Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference
Ref 31Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80. To Reference
Ref 32J Med Chem. 2008 Dec 25;51(24):8019-26.Structural and mechanistic studies of mofegiline inhibition of recombinant human monoamine oxidase B. To Reference
Ref 33Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40. Epub 2009 Nov 26.Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases. To Reference
Ref 34Bioorg Med Chem. 2010 Feb;18(3):1273-9. Epub 2010 Jan 4.A new series of flavones, thioflavones, and flavanones as selective monoamine oxidase-B inhibitors. To Reference
Ref 35Novel monoamine oxidase inhibitors, 3-(2-aminoethoxy)-1,2-benzisoxazole derivatives, and their differential reversibility. Jpn J Pharmacol. 2002 Feb;88(2):174-82. To Reference
Ref 36Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.Binding of an imidazopyridoindole at imidazoline I2 receptors. To Reference
Ref 37Daws LC, Irvine RJ, Callaghan PD, Toop NP, White JM, Bochner F: Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543