Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00432

Target Information
NameCalmodulin    
Type of targetSuccessful target    
DiseaseAtopic asthma
[ICD9: 493   ICD10: J45]
[1]
Cancer, unspecific
[ICD9: 140-229   ICD10: C00-C96]
[2]
Drug(s)AprindineApprovedCardiac arrhythmias[3]
TrifluoperazineApprovedSchizophrenia[4]
UniProt IDP02593
PDB Structure1CMF; 1CMG; 1DEG; 1FW4; 1LIN; 1PRW; 1QIV; 1QIW.    
FunctionCalmodulin mediates the control of a large number of enzymes by ca(2+). Among the enzymes to be stimulated by the calmodulin-ca(2+) complex are a number of protein kinases and phosphatases.    
SequenceMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEF
Target ValidationClick to Find Target Validation Information.    
Inhibitor2-Methyl-2,4-Pentanediol[5]
2-Methyl-2-Propanol[5]
Acetate Ion[5]
Aprindine[3]
Cacodylate Ion[5]
MYRISTIC ACID[6]
N-Trimethyllysine[5]
Trifluoperazine[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Ca2+ sensors modulate asthmatic symptoms in an allergic model for asthma. Eur J Pharmacol. 2003 Aug 22;476(1-2):151-7. To Reference
Ref 2Calmodulin: a potential target for cancer chemotherapeutic agents. J Clin Oncol. 1986 Jun;4(6):994-1012. To Reference
Ref 3Aprindine inhibits calmodulin-stimulated phosphodiesterase and Ca-ATPase activities. J Cardiovasc Pharmacol. 1983 Jan-Feb;5(1):151-6. To Reference
Ref 4Inhibitory effect of jujuboside A on glutamate-mediated excitatory signal pathway in hippocampus. Planta Med. 2003 Aug;69(8):692-5. To Reference
Ref 5Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 6Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543