Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00485

Target Information
NameCalcitonin receptor    
Type of targetSuccessful target    
SynonymsCALCR    
CT-R    
DiseasePost-menopausal osteoporosis
[ICD9: 627.2, 733.0   ICD10: M80-M81, N95.0]
[1][2]
Drug(s)Salmon CalcitoninApprovedOsteoporosis[1][2]
UniProt IDP30988
FunctionThis is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.    
SequenceMRFTFTSRCLALFLLLNHPTPILPAFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQ QLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFK HPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRKLTTIF PLNWKYRKALSLGCQRVTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHF FHQYMMACNYFWMLCEGIYLHTLIVVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVY FNDNCWLSVETHLLYIIHGPVMAALVVNFFFLLNIVRVLVTKMRETHEAESHMYLKAVKA TMILVPLLGIQFVVFPWRPSNKMLGKIYDYVMHSLIHFQGFFVATIYCFCNNEVQTTVKR QWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQEPRNEPANNQGEESAEIIP LNIIEQESSA
Target ValidationClick to Find Target Validation Information.    
InhibitorCGNLSTCBLGTYTQDFNKFHZYPQTAIGVGAP-amide[3]
CGNLSTCBLGTYTQDF[DKFHO]YPQTAIGVGAP-amide[3]
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-amide[3]
CGNLSTCMLGTYTQDFNKPHTFPQTAIGVGAP-amide[3]
CGNLSTCMLGTYTQDFNPFHTFPQTAIGVGAP-amide[3]
CGNLSTCMLGTYTQDFNPKHTFPQTAIGVGAP-amide[3]
CGNLSTCMLGTYTQDFc[DKFHK]FPQTAIGVGAP-amide[3]
CGNLSTCMLGTYTQDFc[DKFHO]FPQTAIGVGAP-amide[3]
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-amide[3]
CSNLSTCVLGKLSQELNKLHBYPRTNTGSGTP-amide[3]
CSNLSTCVLGKLSQELc[DKLHK]YPRTNTGSGTP-amide[3]
CSNLSTCVLGKLSQELc[DKLHO]YPRTNTGSGTP-amide[3]
CSNLSTCVLGKLSQELc[DKLQK]YPRTNTGSGTP-amide[3]
BinderSalmon Calcitonin[1][2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Improved absorption of salmon calcitonin by ultraflexible liposomes through intranasal delivery. Peptides. 2009 Jul;30(7):1288-95. Epub 2009 Apr 7. To Reference
Ref 2Purification and characterization of calcitonin receptors in rat kidney membranes by covalent cross-linking techniques. Eur J Biochem. 1986 Feb 17;155(1):141-7. To Reference
Ref 3J Med Chem. 2002 Feb 28;45(5):1108-21.Side-chain lactam-bridge conformational constraints differentiate the activities of salmon and human calcitonins and reveal a new design concept for potent calcitonin analogues. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543