Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
   

 

TTD Target ID: TTDS00489

Target Information
NameFolate receptor    
Type of targetSuccessful target    
SynonymsFOLR    
FR    
DiseaseDietary shortage
[ICD9: 260-269   ICD10: E40-E46]
[1]
Folic acid deficiency
[ICD9: 266.2   ICD10: E53.8]
[2]
Drug(s)Folic AcidApprovedFolate deficiency[2]
Tetrahydrofolic acidApprovedDietary shortage[1]
FarletuzumabPhase IIIOvarian cancer[3]
UniProt IDP14207
P41439
FunctionBinds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform short does not bind folate.    
SequenceMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKK NACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQ SWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYF PTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGI IDS
AntagonistFarletuzumab[3]
BinderFolic Acid[2]
Tetrahydrofolic acid[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Common mutations at the homocysteine metabolism pathway and pediatric stroke. Thromb Res. 2001 Apr 15;102(2):115-20. To Reference
Ref 2Gamma-glutamyl hydrolase and drug resistance. Clin Chim Acta. 2006 Dec;374(1-2):25-32. Epub 2006 Jun 10. To Reference
Ref 3Emerging drugs for ovarian cancer. Expert Opin Emerg Drugs. 2008 Sep;13(3):523-36. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543