Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDC00058

Target Information
NameSphingosine kinase    
Type of targetClinical trial target    
SynonymsSK    
SPHK    
SPK    
DiseaseLate-Stage Ovarian cancer    [1]
Prostate cancer    [1]
Drug(s)PhenoxodiolPhase IIILate-Stage Ovarian Cancer[1]
PhenoxodiolPhase IIProstate Cancer[1]
EC NumberEC 2.7.1.91
UniProt IDQ9NYA1
SequenceMDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW MVSGCVEPPPSWKPQQMPPPEEPL
Target ValidationClick to Find Target Validation Information.    
Inhibitor (R)-2-amino-3-[2]
(R)-2-amino-4-hydroxy-N-[2]
(S)-2-amino-4-hydroxy-N-[2]
(S)-2-amino-6-hydroxy-N-[2]
DIMETHYLSPINGOSINE[3]
Phenoxodiol[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Int J Cancer. 2006 May 15;118(10):2412-20.Phenoxodiol, an experimental anticancer drug, shows potent antiangiogenic properties in addition to its antitumour effects. To Reference
Ref 2Bioorg Med Chem Lett. 2009 Nov 1;19(21):6119-21. Epub 2009 Sep 10.Discovery of novel sphingosine kinase 1 inhibitors. To Reference
Ref 3J Med Chem. 2009 Jun 25;52(12):3618-26.Synthesis and evaluation of sphingosine analogues as inhibitors of sphingosine kinases. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543