Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDC00280

Target Information
NamemRNA of Inhibitor of apoptosis protein    
Type of targetClinical trial target    
SynonymsBaculoviral IAP repeat-containing protein 4    
HILP    
IAP-like protein    
Inhibitor of apoptosis protein 3    
X-linked IAP    
X-linked inhibitor of apoptosis    
X-linked inhibitor of apoptosis protein    
XIAP    
DiseaseHepatocellular carcinoma    [1]
Neoplasms    [2]
Ovarian cancer    [3]
Drug(s)AEG35156Phase I/IIRelapsed or refractory chronic lymphocytic leukaemia; small lymphocytic lymphoma; follicular lymphoma; advanced non-small-cell lung cancer; and advanced pancreatic cancer[4]
BioChemical ClassLigases forming carbon-nitrogen bonds    
PathwayApoptosis
Focal adhesion
Pathways in cancer
Small cell lung cancer
Ubiquitin mediated proteolysis
UniProt IDP98170
PDB Structure1G3F; 1KMC; 1NW9; 1TFQ; 1TFT; 2ECG; 2JK7; 2OPY.    
FunctionApoptotic suppressor. Inhibitor of caspase-3, -7 and -9.    
SequenceMTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK CPMCYTVITFKQKIFMS
Target ValidationClick to Find Target Validation Information.    
InhibitorARPFAQK-FAM[5]
AVPIAQKSEK-FAM[5]
EMBELIN[5]
SM-122[6]
SM-131[7]
SM-337[6]
siRNAAEG35156[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Overexpression of X-linked inhibitor of apoptosis in human hepatocellular carcinoma. Int J Mol Med. 2003 Nov;12(5):705-8. To Reference
Ref 2X-linked inhibitor of apoptosis protein (XIAP) is a nonredundant modulator of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis in human cancer cells. Cancer Res. 2004 May 1;64(9):3006-8. To Reference
Ref 3Apoptosis and chemoresistance in human ovarian cancer: is Xiap a determinant? Biol Signals Recept. 2000 Mar-Apr;9(2):122-30. To Reference
Ref 4Teaming up to tackle RNAi delivery challenge. Nat Rev Drug Discov. 2009 Jul;8(7):525-6. To Reference
Ref 5J Med Chem. 2004 May 6;47(10):2430-40.Discovery of embelin as a cell-permeable, small-molecular weight inhibitor of XIAP through structure-based computational screening of a traditional herbal medicine three-dimensional structure database. To Reference
Ref 6J Med Chem. 2010 Sep 9;53(17):6361-7.Nonpeptidic and potent small-molecule inhibitors of cIAP-1/2 and XIAP proteins. To Reference
Ref 7J Med Chem. 2008 Dec 11;51(23):7352-5.Design, synthesis, and evaluation of tricyclic, conformationally constrained small-molecule mimetics of second mitochondria-derived activator of caspases. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543