Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDC00307

Target Information
NameFK506-binding protein 1A    
Type of targetClinical trial target    
Synonyms12 kDa FKBP    
FK-binding protein 12    
FKBP-12    
Immunophilin FKBP12    
Immunophillin FKBP    
PPIase    
Peptidyl-prolyl cis-trans isomerase    
Rotamase    
DiseaseAutoimmune diseases    [1]
Drug(s)GPI-1485Phase II completedParkinson¡¯s Disease[2]
EC NumberEC 5.2.1.8
UniProt IDP20071
PDB Structure1A7X; 1B6C; 1BKF; 1BL4; 1D6O; 1D7H; 1D7I; 1D7J.    
FunctionMay play a role in modulation of ryanodine receptor isoform-1 (RYR-1), a component of the calcium release channel of skeletal muscle sarcoplasmic reticulum. There are four molecules of FKBP12 per skeletal muscle RYR.    
SequenceMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Related US Patent6,495,549
6,509,464
6,562,964
Target ValidationClick to Find Target Validation Information.    
Inhibitor4-Hydroxy-2-Butanone[3]
FKB-001[3]
Gpi-1046[4]
Heptyl-Beta-D-Glucopyranoside[5]
L-709,587[3]
MYRISTIC ACID[4]
Methyl Methylsulfinylmethyl Sulfide[3]
Rapamycin Immunosuppressant Drug[3]
BinderRapamycin[1]
LigandGPI-1485[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Neural roles of immunophilins and their ligands. Mol Neurobiol. 1997 Oct;15(2):223-39. To Reference
Ref 2Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. To Reference
Ref 3Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 4Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 5Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543