TTD Target ID: TTDR00152

Target Information
Name	G2/mitotic-specific cyclin B1
Type of target	Research target
Synonyms	Cyclin B1
Disease	Cardiovascular disease, unspecified    [1]
Pathway	Cell cycle
	p53 signaling pathway
UniProt ID	P14635
PDB Structure	2B9R; 2JGZ.
Function	Essential for the control of the cell cycle at the g2/m (mitosis) transition.
Sequence	MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS ALVQDLAKAVAKV
Target Validation	Click to Find Target Validation Information.
Inhibitor	3,4-bis (indol-3-yl)maleimide derivative		[2]
	3,4-di- (4-methoxyphenyl)-1H-pyrrole-2,5-dione		[3]
	3,4-diphenyl-1H-pyrrole-2,5-dione		[3]
	3- (4-methoxyphenyl)-4-phenyl-1H-pyrrole-2,5-dione		[3]
	3- (indole-3-yl)-4-phenyl-1H-pyrrole-2,5-dione		[3]
	4- (Quinolin-3-yl)-N-p-tolylpyrimidin-2-amine		[4]
	4- (Quinolin-4-yl)-N-p-tolylpyrimidin-2-amine		[4]
	AZAKENPAULLONE		[5]
	GF-109203		[2]
	KENPAULLONE		[6]
	RO-316233		[2]
	Thieno analogue of kenpaullone		[5]
Cross References	3D Structure Related Literature On-Line Medical Dictionary
Ref 1	Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. To Reference
Ref 2	Bioorg Med Chem Lett. 1998 May 5;8(9):1019-22.Design of new inhibitors for cdc2 kinase based on a multiple pseudosubstrate structure. To Reference
Ref 3	J Med Chem. 2006 Feb 23;49(4):1271-81.Design, synthesis, and biological evaluation of 3,4-diarylmaleimides as angiogenesis inhibitors. To Reference
Ref 4	Eur J Med Chem. 2010 Jan;45(1):379-86. Epub 2009 Oct 13.Synthesis and cytotoxic activity of 2-methylimidazo[1,2-a]pyridine- and quinoline-substituted 2-aminopyrimidine derivatives. To Reference
Ref 5	Bioorg Med Chem Lett. 2004 Jan 19;14(2):413-6.1-Azakenpaullone is a selective inhibitor of glycogen synthase kinase-3 beta. To Reference
Ref 6	Eur J Med Chem. 2010 Sep;45(9):4316-30. Epub 2010 Jun 30.Discovery of novel CDK1 inhibitors by combining pharmacophore modeling, QSAR analysis and in silico screening followed by in vitro bioassay. To Reference

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.

Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore

All rights reserved.