Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDR00562

Target Information
NameUrotensin II receptor    
Type of targetResearch target    
SynonymsG protein coupled receptor 14    
UR-II-R    
Urotensin-II receptor GPR14    
DiseaseCongestive heart failure    [1]
Myocardial infarction    [1]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayNeuroactive ligand-receptor interaction
UniProt IDQ9UKP6
FunctionHigh afinity receptor for urotensin ii. The activity of this receptor is mediated by a g-protein that activate a phosphatidylinositol-calcium second messenger system.    
SequenceMALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS SCSPQPTDSLVLAPAAPARPAPEGPRAPA
Related US Patent6,514,970
6,544,992
Target ValidationClick to Find Target Validation Information.    
InhibitorAGTAD[CFWKYC]V[2]
Ac-FWKY-NH2[2]
Ac-SFWKYS-NH2[2]
Ac-WKY-NH2[2]
Ac-[CFWKFC]-NH2[2]
Ac-[CFWKYC]-NH2[2]
Ac-[CFWKyC]-NH2[2]
Ac-[CFWkYC]-NH2[2]
Ac-[CFwKYC]-NH2[2]
Ac-[CfWKYC]-NH2[2]
ICI-199441[3]
JNJ-28318706[4]
PALOSURAN[2]
SB-328872[5]
SB-436811[2]
SB-706375[2]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Human urotensin-II, the most potent mammalian vasoconstrictor identified to date, as a therapeutic target for the management of cardiovascular disease. Trends Cardiovasc Med. 2000 Aug;10(6):229-37. To Reference
Ref 2J Med Chem. 2010 Apr 8;53(7):2695-708.Urotensin-II receptor modulators as potential drugs. To Reference
Ref 3Bioorg Med Chem Lett. 2008 Jul 1;18(13):3716-9. Epub 2008 May 20.Potent and selective small-molecule human urotensin-II antagonists with improved pharmacokinetic profiles. To Reference
Ref 4J Med Chem. 2009 Dec 10;52(23):7432-45.Nonpeptide urotensin-II receptor antagonists: a new ligand class based on piperazino-phthalimide and piperazino-isoindolinone subunits. To Reference
Ref 5Bioorg Med Chem Lett. 2008 Jul 15;18(14):3950-4. Epub 2008 Jun 10.Urotensin-II receptor antagonists: synthesis and SAR of N-cyclic azaalkyl benzamides. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543