Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDR00786

Target Information
NameG1/S-specific cyclin E1    
Type of targetResearch target    
SynonymsCyclin E    
G1/S-specific cyclin E    
DiseaseHepatocellular carcinoma    [1]
PathwayCell cycle
Pathways in cancer
Prostate cancer
Small cell lung cancer
p53 signaling pathway
UniProt IDP24864
PDB Structure1W98.    
FunctionEssential for the control of the cell cycle at the g1/s (start) transition.    
SequenceMPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
Target ValidationClick to Find Target Validation Information.    
Inhibitor (2'Z,3'E)-5-Chloro-5'-chloro-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Chloro-5'-fluoro-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Chloro-5'-hydroxy-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Chloro-5'-methyl-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Fluoro-5'-chloro-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Fluoro-5'-fluoro-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Fluoro-5'-hydroxy-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Fluoro-5'-methoxy-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Fluoro-5'-methyl-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Nitro-5'-chloro-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Nitro-5'-fluoro-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Nitro-5'-hydroxy-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Nitro-5'-methoxy-indirubin-3'-oxime[2]
(2'Z,3'E)-5-Nitro-5'-methyl-indirubin-3'-oxime[2]
2- ([3]
3,4-di- (4-methoxyphenyl)-1H-pyrrole-2,5-dione[4]
3,4-diphenyl-1H-pyrrole-2,5-dione[4]
3- ([3]
3- (4-methoxyphenyl)-4-phenyl-1H-pyrrole-2,5-dione[4]
3- (indole-3-yl)-4-phenyl-1H-pyrrole-2,5-dione[4]
4- (7-Butyl-5H-pyrrolo[2,3-b]pyrazin-6-yl)-phenol[5]
4-[ (3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol[3]
5-nitroindirubin-3'-oxime[2]
BMS-536924[6]
PD-0183812[7]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Use of RNA interference to target cyclin E-overexpressing hepatocellular carcinoma. Cancer Res. 2003 Jul 1;63(13):3593-7. To Reference
Ref 2J Med Chem. 2010 May 13;53(9):3696-706.5,5'-substituted indirubin-3'-oxime derivatives as potent cyclin-dependent kinase inhibitors with anticancer activity. To Reference
Ref 3J Med Chem. 2006 Nov 2;49(22):6500-9.4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects. To Reference
Ref 4J Med Chem. 2006 Feb 23;49(4):1271-81.Design, synthesis, and biological evaluation of 3,4-diarylmaleimides as angiogenesis inhibitors. To Reference
Ref 5J Med Chem. 2003 Jan 16;46(2):222-36.Aloisines, a new family of CDK/GSK-3 inhibitors. SAR study, crystal structure in complex with CDK2, enzyme selectivity, and cellular effects. To Reference
Ref 6J Med Chem. 2005 Sep 8;48(18):5639-43.Discovery of a (1H-benzoimidazol-2-yl)-1H-pyridin-2-one (BMS-536924) inhibitor of insulin-like growth factor I receptor kinase with in vivo antitumor activity. To Reference
Ref 7J Med Chem. 2000 Nov 30;43(24):4606-16.Pyrido[2,3-d]pyrimidin-7-one inhibitors of cyclin-dependent kinases. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543