Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00012

Target Information
NameD(2) dopamine receptor    
Type of targetSuccessful target    
SynonymsDopamine D2 receptor    
Dopamine receptor 2    
DiseaseAnxiety disorder, unspecified    [1]
Attention deficit hyperactivity disorder    [2]
Cocaine dependence    [3]
Cognitive deficits    [4]
Delusional disorder    [5]
Depression    [1]
Disabling peak-dose dyskinesias    [6]
Erectile dysfunction    [7]
Gastric emptying disorders    [8]
Gilles de la Tourette's disorder    [2]
Nausea and vomiting    [9]
Neuroleptic malignant syndrome    [10]
Neurological diseases    [11]
Parkinson's disease    [12][13]
Psychiatric illness    [14]
Respiratory diseases    [11]
Schizophrenia    [1]
Vomiting    [15]
Drug(s)AcetophenazineApprovedFalse perceptions (e.g. hallucinations or delusions.)[16][17]
AmisulprideApprovedSchizophrenia[18][19][16]
AripiprazoleApprovedSchizophrenia[20]
AsenapineApprovedSchizophrenia and bipolar disorder[21][22]
BromocriptineApprovedParkinson's disease[23][24][25]
CabergolineApprovedHyperprolactinemic disorders[26][27]
CarphenazineApprovedSchizophrenia[16][28]
ChlorpromazineApprovedSchizophrenia[29][30][1]
ChlorprothixeneApprovedPsychotic disorders[31]
ClozapineApprovedSchizophrenia[16][32]
Dapotum DApprovedAscariasis and enterobiasis[33][34]
DexamfetamineApprovedAttention-deficit hyperactivity disorder[35]
DihydroergotoxineApprovedAlzheimer's disease[36]
Domperidone maleateApprovedUpper gastrointestinal motility disorders[37][8][15]
DopamineApprovedParkinson's Disease[38][39]
FlupenthixolApprovedSchizophrenia[40][16]
FluphenazineApprovedPsychotic disorders[33][16]
FluspirileneApprovedSchizophrenia[41]
HaloperidolApprovedSchizophrenia[42][16]
IloperidoneApprovedSchizophrenia[21][43]
LoxapineApprovedPsychotic disorders[6]
MesoridazineApprovedSchizophrenia[44]
MethamfetamineApprovedPain and inflammatory diseases[45]
MetoclopramideApprovedNausea and vomiting[46][8][8]
MolindoneApprovedSchizophrenia[47][48]
OlanzapineApprovedSchizophrenia[49]
PaliperidoneApprovedSchizophrenia[50][16]
PergolideApprovedParkinson's disease[51]
PerphenazineApprovedSchizophrenia and bipolar disorder[52][53]
PimozideApprovedSchizophrenia[54][16]
PramipexoleApprovedParkinson's disease[55]
ProchlorperazineApprovedNausea and vomiting[56][57]
QuetiapineApprovedSchizophrenia[58][16]
QuinagolideApprovedHyperprolactinaemia[11]
Quinagolide hydrochlorideApprovedHigh prolactin levels[11]
RemoxiprideApprovedSchizophrenia[16][6]
RisperidoneApprovedSchizophrenia[59][50]
RopiniroleApprovedParkinson's disease[60][11]
SertindoleApprovedSchizophrenia[61][62]
SulpirideApprovedSchizophrenia[63][4][64]
ZiprasidoneApprovedSchizophrenia[65]
ZuclopenthixolApprovedSchizophrenia[66][16]
NemonaprideLaunchedSchizophrenia[43]
PD-172760LaunchedSchizophrenia[43]
Quetiapine SRPhase IVPanic Disorder, Severe Mood Disorders, Schizophrenia[67]
Risperidone ConstaPhase IVBipolar disorder[22]
Lurasidone hydrochloridePhase III completedSchizophrenia[43]
Rotigotine patchPhase III completedRestless legs syndrome, Parkinsoní»s disease[68]
SumanirolePhase III completedParkinsoní»s Disease[69]
BlonanserinPhase IIISchizophrenia[43]
N-0923Phase II completedParkinsoní»s Disease[69]
Aplindore fumaratePhase IISchizophrenia[43][70]
OcaperidonePhase IISchizophrenia[43]
PardoprunoxPhase IIAdvanced Stage Parkinson's Disease[67]
SSR-181507Phase ISchizophrenia[43]
(S)-amisulprideTerminated in Phase IVSchizophrenia[43]
1192U90DiscontinuedSchizophrenia[43]
BifeprunoxTeminated in Phase IIISchizophrenia[43][50]
LamectacinSuspended in Phase IIIBacterial infections[22][71]
NomifensineWithdrawalEndogenous depression[72][73]
SDZ-HDC-912DiscontinuedSchizophrenia[43]
SLV-310Suspended in Phase IISchizophrenia[43]
SLV-313Terminated in Phase ISchizophrenia[43]
SLV-319Suspended in Phase IObesity, Psychosis[74]
SibenadetDiscontinued in Phase IIIChronic obstructive pulmonary disease[75]
(-)-3PPP, MarylandNo development reportedSchizophrenia[43]
Abaperidone hydrochlorideNo development reportedSchizophrenia[43]
Dopamine antagsNo development reportedSchizophrenia[43]
GMC-283No development reportedSchizophrenia[43]
HMR-2934No development reportedSchizophrenia[43]
Org-23366No development reportedSchizophrenia[43]
SDZ-MAR-327No development reportedSchizophrenia[43]
Y-931No development reportedSchizophrenia[43]
ZD-3638No development reportedSchizophrenia[43]
D1 agonist D2 antagonistPreclinicalSchizophrenia[43]
PD-157695PreclinicalSchizophrenia[43]
PD-158771PreclinicalSchizophrenia[43]
S32504PreclinicalParkinsoní»s Disease[69]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayGap junction
Neuroactive ligand-receptor interaction
UniProt IDP14416
PDB Structure1I15; 2HLB.    
FunctionThis is one of the five types (D1 to D5) of receptors for dopamine, and the activity of this receptor is mediated by g proteins which activate adenylyl cyclase.    
SequenceMDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC
Related US Patent6,277,875
6,300,365
Target ValidationClick to Find Target Validation Information.    
Agonist (-)-3PPP, Maryland[43]
Aplindore fumarate[43][70]
Aripiprazole[20]
Bifeprunox[43][50]
Bromocriptine[23][24][25]
Cabergoline[26][27]
Dexamfetamine[35]
Dihydroergotoxine[36]
Dopamine[38][39]
Mesoridazine[44]
Methamfetamine[45]
N-0923[69]
Nemonapride[43]
Olanzapine[49]
Pardoprunox[67]
Pergolide[51]
Pramipexole[55]
Quetiapine[58][16]
Quinagolide[11]
Quinagolide hydrochloride[11]
Ropinirole[60][11]
Rotigotine patch[68]
S32504[69]
SDZ-MAR-327[43]
SLV-313[43]
Sibenadet[75]
Sumanirole[69]
Ziprasidone[65]
Antagonist (S)-amisulpride[43]
1192U90[43]
Abaperidone hydrochloride[43]
Acetophenazine[16][17]
Amisulpride[18][19][16]
Asenapine[21][22]
Blonanserin[43]
Carphenazine[16][28]
Chlorpromazine[29][30][1]
Chlorprothixene[31]
Clozapine[16][32]
Dapotum D[33][34]
Domperidone maleate[37][8][15]
Flupenthixol[40][16]
Fluphenazine[33][16]
Fluspirilene[41]
GMC-283[43]
HMR-2934[43]
Haloperidol[42][16]
Iloperidone[21][43]
Lamectacin[22][71]
Loxapine[6]
Lurasidone hydrochloride[43]
Metoclopramide[46][8][8]
Nomifensine[72][73]
Ocaperidone[43]
Org-23366[43]
PD-157695[43]
PD-158771[43]
PD-172760[43]
Paliperidone[50][16]
Perphenazine[52][53]
Pimozide[54][16]
Prochlorperazine[56][57]
Quetiapine SR[67]
Remoxipride[16][6]
Risperidone[59][50]
Risperidone Consta[22]
SLV-310[43]
SLV-319[74]
Sertindole[61][62]
Sulpiride[63][4][64]
Zuclopenthixol[66][16]
BinderDopamine antags[43]
Molindone[47][48]
SDZ-HDC-912[43]
SSR-181507[43]
Y-931[43]
ZD-3638[43]
Multitarget1192U90[43]
Abaperidone hydrochloride[43]
Asenapine[21][22]
Bifeprunox[43][50]
Blonanserin[43]
Dexamfetamine[35]
GMC-283[43]
HMR-2934[43]
Iloperidone[21][43]
Lurasidone hydrochloride[43]
Ocaperidone[43]
Org-23366[43]
PD-157695[43]
PD-158771[43]
Pergolide[51]
Pramipexole[55]
Risperidone Consta[22]
Ropinirole[60][11]
SDZ-MAR-327[43]
SLV-310[43]
SLV-313[43]
SLV-319[74]
SSR-181507[43]
Sibenadet[75]
ZD-3638[43]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Behavioral and neurochemical methods in research on new psychotropics. Ann Pharm Fr. 1998;56(2):54-9. To Reference
Ref 2Effects of pimozide on cognition in children with Tourette syndrome: interaction with comorbid attention deficit hyperactivity disorder. Acta Psychiatr Scand. 1994 Jul;90(1):4-9. To Reference
Ref 3Acute and chronic effects of flupenthixol on the discriminative stimulus and reinforcing effects of cocaine in rhesus monkeys. J Pharmacol Exp Ther. 1996 Aug;278(2):879-90. To Reference
Ref 4D(2) dopamine receptors enable delta(9)-tetrahydrocannabinol induced memory impairment and reduction of hippocampal extracellular acetylcholine concentration. Br J Pharmacol. 2000 Jul;130(6):1201-10. To Reference
Ref 5Delusional disorder: molecular genetic evidence for dopamine psychosis. Neuropsychopharmacology. 2002 Jun;26(6):794-801. To Reference
Ref 6Remoxipride in Parkinson's disease: differential response in patients with dyskinesias fluctuations versus psychosis. Clin Neuropharmacol. 1995 Feb;18(1):39-45. To Reference
Ref 7Dopamine and male sexual function. Eur Urol. 2001 Dec;40(6):601-8. To Reference
Ref 8The significance of disordered gastric emptying. Z Gastroenterol. 1986 Sep;24 Suppl 2:45-54. To Reference
Ref 9Metoclopramide for nausea and vomiting of pregnancy: a prospective multicenter international study. Am J Perinatol. 2002 Aug;19(6):311-6. To Reference
Ref 10Neuroleptic malignant syndrome after venlafaxine. Lancet. 2000 Jan 22;355(9200):289-90. To Reference
Ref 11Effect of dopamine receptor agonists on sensory nerve activity: possible therapeutic targets for the treatment of asthma and COPD. Br J Pharmacol. 2002 Jun;136(4):620-8. To Reference
Ref 12Effects of talipexole on emesis-related changes in abdominal afferent vagal activity and ileal serotonin metabolism in rats. Res Commun Mol Pathol Pharmacol. 1997 Jan;95(1):67-82. To Reference
Ref 13Tolerance to some behavioural effects of lisuride, a dopamine receptor agonist, and reverse tolerance to others, after repeated administration. Neuropharmacology. 1985 Mar;24(3):199-206. To Reference
Ref 14New neuroleptic agents and new models for psychoses. Ann Med Psychol (Paris). 1995 Feb;153(2):106-20. To Reference
Ref 15Effects of dopamine receptor antagonists on gastrin and vomiting responses to apomorphine. Naunyn Schmiedebergs Arch Pharmacol. 1987 Jul;336(1):16-9. To Reference
Ref 16Atypical antipsychotics: mechanism of action. Can J Psychiatry. 2002 Feb;47(1):27-38. To Reference
Ref 17Specific therapeutic actions of acetophenazine, perphenazine, and benzquinamide in newly admitted schizophrenic patients. Clin Pharmacol Ther. 1967 Mar-Apr;8(2):249-55. To Reference
Ref 18Mechanism of action of atypical antipsychotic drugs and the neurobiology of schizophrenia. CNS Drugs. 2006;20(5):389-409. To Reference
Ref 19Amisulpride: a review of its use in the management of schizophrenia. CNS Drugs. 2004;18(13):933-56. To Reference
Ref 20Aripiprazole acts as a selective dopamine D2 receptor partial agonist. Expert Opin Investig Drugs. 2007 Jun;16(6):771-5. To Reference
Ref 21Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92. To Reference
Ref 22Emerging drugs for bipolar disorder. Expert Opin Emerg Drugs. 2006 Nov;11(4):621-34. To Reference
Ref 23Silymarin BIO-C, an extract from Silybum marianum fruits, induces hyperprolactinemia in intact female rats. Phytomedicine. 2009 Sep;16(9):839-44. Epub 2009 Mar 20. To Reference
Ref 24Striatal dopamine predicts outcome-specific reversal learning and its sensitivity to dopaminergic drug administration. J Neurosci. 2009 Feb 4;29(5):1538-43. To Reference
Ref 25The behavioral toxicity of bromocriptine in patients with psychiatric illness. J Clin Psychopharmacol. 1989 Dec;9(6):417-22. To Reference
Ref 26Role of D1 and D2 receptors in the regulation of voluntary movements. Bull Exp Biol Med. 2008 Jul;146(1):14-7. To Reference
Ref 27Protection against paraquat and A53T alpha-synuclein toxicity by cabergoline is partially mediated by dopamine receptors. J Neurol Sci. 2009 Mar 15;278(1-2):44-53. Epub 2008 Dec 21. To Reference
Ref 28Comparison of dosage ranges of carphenazine and trifluoperazine in elderly chronic schizophrenics. Dis Nerv Syst. 1968 Oct;29(10):695-7. To Reference
Ref 29Modulatory role of dopamine D2 receptors and fundamental role of L-type Ca2+ channels in the induction of long-term potentiation in the basolateral amygdala-dentate gyrus pathway of anesthetized rats. Eur J Pharmacol. 2009 Mar 15;606(1-3):90-3. Epub 2009 Jan 22. To Reference
Ref 30Basolateral amygdala D1- and D2-dopaminergic system promotes the formation of long-term potentiation in the dentate gyrus of anesthetized rats. Prog Neuropsychopharmacol Biol Psychiatry. 2009 Apr 30;33(3):552-6. Epub 2009 Feb 23. To Reference
Ref 31Potential utility of histamine H3 receptor antagonist pharmacophore in antipsychotics. Bioorg Med Chem Lett. 2009 Jan 15;19(2):538-42. Epub 2008 Sep 7. To Reference
Ref 32N-desmethylclozapine: is there evidence for its antipsychotic potential? Clin Neuropharmacol. 2009 May-Jun;32(3):154-7. To Reference
Ref 33The antipsychotic drug, fluphenazine, effectively reverses mechanical allodynia in rat models of neuropathic pain. Psychopharmacology (Berl). 2008 Jan;195(4):559-68. Epub 2007 Sep 23. To Reference
Ref 34The effects of chronic neuroleptic treatment on neurotensin-like immunoreactivity in the rat central nervous system. Brain Res. 1985 Jun 3;335(2):334-6. To Reference
Ref 35Attention-deficit hyperactivity disorder: treatment discontinuation in adolescents and young adults. Br J Psychiatry. 2009 Mar;194(3):273-7. To Reference
Ref 36Pharmacologic management of Alzheimer disease, Part II: Antioxidants, antihypertensives, and ergoloid derivatives. Ann Pharmacother. 1999 Feb;33(2):188-97. To Reference
Ref 37Screening of domperidone in wastewater by high performance liquid chromatography and solid phase extraction methods. Talanta. 2006 Jan 15;68(3):928-31. Epub 2005 Jul 22. To Reference
Ref 38The Detection of Dopamine Gene Receptors (DRD1-DRD5) Expression on Human Peripheral Blood Lymphocytes by Real Time PCR. Iran J Allergy Asthma Immunol. 2004 Dec;3(4):169-74. To Reference
Ref 39Polymorphisms in dopamine receptor DRD1 and DRD2 genes and psychopathological and extrapyramidal symptoms in patients on long-term antipsychotic treatment. Am J Med Genet B Neuropsychiatr Genet. 2007 Sep 5;144B(6):809-15. To Reference
Ref 40A role for medial prefrontal dopaminergic innervation in instrumental conditioning. J Neurosci. 2009 May 20;29(20):6599-606. To Reference
Ref 41Inhibition of glutamate release by fluspirilene in cerebrocortical nerve terminals (synaptosomes). Synapse. 2002 Apr;44(1):36-41. To Reference
Ref 42Dopaminergic synapses in the matrix of the ventrolateral striatum after chronic haloperidol treatment. Synapse. 2002 Aug;45(2):78-85. To Reference
Ref 43The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. To Reference
Ref 44Intrinsic efficacy of antipsychotics at human D2, D3, and D4 dopamine receptors: identification of the clozapine metabolite N-desmethylclozapine as a D2/D3 partial agonist. J Pharmacol Exp Ther. 2005 Dec;315(3):1278-87. Epub 2005 Aug 31. To Reference
Ref 45Pharmacotherapy for obesity. Drugs. 2005;65(10):1391-418. To Reference
Ref 46Mechanisms for metoclopramide-mediated sensitization and haloperidol-induced catalepsy in rats. Eur J Pharmacol. 2008 Jun 10;587(1-3):181-6. Epub 2008 Apr 6. To Reference
Ref 47Molindone for schizophrenia and severe mental illness. Cochrane Database Syst Rev. 2007 Jan 24;(1):CD002083. To Reference
Ref 48Antipsychotic drugs which elicit little or no parkinsonism bind more loosely than dopamine to brain D2 receptors, yet occupy high levels of these receptors. Mol Psychiatry. 1998 Mar;3(2):123-34. To Reference
Ref 49Olanzapine: an updated review of its use in the management of schizophrenia. Drugs. 2001;61(1):111-61. To Reference
Ref 50Upcoming agents for the treatment of schizophrenia: mechanism of action, efficacy and tolerability. Drugs. 2008;68(16):2269-92. To Reference
Ref 51Dopamine and cognitive functioning in de novo subjects with Parkinson's disease: effects of pramipexole and pergolide on working memory. Neuropsychologia. 2009 Apr;47(5):1374-81. Epub 2009 Feb 7. To Reference
Ref 52CYP2D6 and DRD2 genes differentially impact pharmacodynamic sensitivity and time course of prolactin response to perphenazine. Pharmacogenet Genomics. 2007 Nov;17(11):989-93. To Reference
Ref 53A cross-validation study on the relationship between central D2 receptor occupancy and serum perphenazine concentration. Psychopharmacology (Berl). 2004 Sep;175(2):148-53. Epub 2004 Mar 6. To Reference
Ref 54The benzamides tiapride, sulpiride, and amisulpride in treatment for Tourette's syndrome. Nervenarzt. 2007 Mar;78(3):264, 266-8, 270-1. To Reference
Ref 55Antiparkinsonian medication and pathological gambling. CNS Drugs. 2008;22(5):407-16. To Reference
Ref 56In vitro and in vivo characteristics of prochlorperazine oral disintegrating film. Int J Pharm. 2009 Feb 23;368(1-2):98-102. Epub 2008 Oct 15. To Reference
Ref 57Tardive dyskinesia as a result of long-term prochlorperazine use. South Med J. 1996 Oct;89(10):989-91. To Reference
Ref 58Receptor reserve-dependent properties of antipsychotics at human dopamine D2 receptors. Eur J Pharmacol. 2009 Apr 1;607(1-3):35-40. Epub 2009 Feb 13. To Reference
Ref 59Randomized clinical comparison of perospirone and risperidone in patients with schizophrenia: Kansai Psychiatric Multicenter Study. Psychiatry Clin Neurosci. 2009 Jun;63(3):322-8. To Reference
Ref 60The relevance of dopamine agonists in the treatment of depression. Neuropsychiatr. 2009;23(1):15-25. To Reference
Ref 61Effect of sertindole on extracellular dopamine, acetylcholine, and glutamate in the medial prefrontal cortex of conscious rats: a comparison with risperidone and exploration of mechanisms involved. Psychopharmacology (Berl). 2009 Jun 9. [Epub ahead of print] To Reference
Ref 62Dopamine D2(High) receptors moderately elevated by sertindole. Synapse. 2008 May;62(5):389-93. To Reference
Ref 63The treatment of Tourette's syndrome: current opinions. Expert Opin Pharmacother. 2002 Jul;3(7):899-914. To Reference
Ref 64The effects of antipsychotic drugs on Fos protein expression in the prefrontal cortex: cellular localization and pharmacological characterization. Neuroscience. 1996 Jan;70(2):377-89. To Reference
Ref 65Striatal and extrastriatal D2/D3-receptor-binding properties of ziprasidone: a positron emission tomography study with [18F]Fallypride and [11C]raclopride (D2/D3-receptor occupancy of ziprasidone). J Clin Psychopharmacol. 2008 Dec;28(6):608-17. To Reference
Ref 66An ethopharmacological assessment of the effects of zuclopenthixol on agonistic interactions in male mice. Methods Find Exp Clin Pharmacol. 1999 Jan-Feb;21(1):11-5. To Reference
Ref 67Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. To Reference
Ref 68Emerging drugs for restless legs syndrome. Expert Opin Emerg Drugs. 2005 Aug;10(3):537-52. To Reference
Ref 69Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. To Reference
Ref 70Eur J Pharmacol. 2006 Dec 15;552(1-3):36-45. Epub 2006 Sep 14.Aplindore (DAB-452), a high affinity selective dopamine D2 receptor partial agonist. To Reference
Ref 71How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30. To Reference
Ref 72Pharmacologically induced, subsecond dopamine transients in the caudate-putamen of the anesthetized rat. Synapse. 2007 Jan;61(1):37-9. To Reference
Ref 73Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9. To Reference
Ref 74Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60. To Reference
Ref 75Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543