Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00013

Target Information
NameD(3) dopamine receptor    
Type of targetSuccessful target    
SynonymsDopamine receptor 3    
DiseaseDrug dependence    [1]
Neurological diseases    [2]
Psychiatric illness    [2]
Respiratory diseases    [3]
Schizophrenia    [1]
Drug(s)PramipexoleApprovedParkinson's disease[4]
RopiniroleApprovedParkinson's disease[5][3]
PF-217830Phase IISchizophrenia[6]
GSK618334Phase I completedDrug dependency[7]
Pfizer 10Phase IFemale sexual dysfunction[8]
GSK598809Suspended in Phase I in GSK 2009 ReportDrug dependency[7]
RGH-1756DiscontinuedSchizophrenia[9]
SarizotanDiscontinued in Phase IIParkinsoní»s Disease[10]
AVE-5997EFNo development reportedSchizophrenia[9]
BP4.879aNo development reportedSchizophrenia[9]
BTS-79018No development reportedSchizophrenia[9]
PNU-177864No development reportedSchizophrenia[9]
SB-277011No development reportedSchizophrenia[9]
PD-157533PreclinicalSchizophrenia[9]
PD-157695PreclinicalSchizophrenia[9]
PD-158771PreclinicalSchizophrenia[9]
S32504PreclinicalParkinsoní»s Disease[10]
U-99194APreclinicalSchizophrenia[9]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayNeuroactive ligand-receptor interaction
UniProt IDP35462
FunctionThis is one of the five types (D1 to D5) of receptors for dopamine, and the activity of this receptor is mediated by g proteins which activate adenylyl cyclase.    
SequenceMASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Related US Patent6,277,875
6,300,365
Target ValidationClick to Find Target Validation Information.    
Inhibitor (+)-BUTACLAMOL[11]
(+/-)-7-hydroxy-2-[12]
(+/-)-nantenine[13]
(-)-3-[14]
(-)-5-hydroxy-2-[15]
(-)3-[14]
(2-Benzyl-phenyl)-[16]
(4-Dipropylamino-cyclohexylidene)-acetonitrile[17]
(4-Phenylethynyl-cyclohex-3-enyl)-dipropyl-amine[17]
(R)-[18]
(R)-[18]
(R)-2-[19]
1- (4-[20]
1- (4-[21]
1-Benzyl-4- (2-ethynyl-pyrrol-1-yl)-piperidine[22]
1-Benzyl-4- (2-iodo-pyrrol-1-yl)-piperidine[22]
1-Benzyl-4- (2-oxazol-5-yl-pyrrol-1-yl)-piperidine[22]
1-Benzyl-4- (3-oxazol-5-yl-pyrrol-1-yl)-piperidine[22]
1-Benzyl-4-pyrrol-1-yl-piperidine[22]
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine[23]
1-Propyl-3- (3-trifluoromethyl-phenyl)-pyrrolidine[24]
1-[2- (2-Benzyl-phenoxy)-ethyl]-piperidine[16]
1-[2- (2-Benzyl-phenoxy)-ethyl]-pyrrolidine[16]
1-[3- (2-Benzyl-phenoxy)-propyl]-pyrrolidine[16]
2- (4-Dipropylamino-cyclohexylidene)-malononitrile[17]
3- (1-Propyl-piperidin-3-yl)-phenol[25]
3- (1-Propyl-pyrrolidin-3-yl)-phenol[24]
3- (2-Benzylamino-ethoxy)-phenol[26]
3- (4-Benzyl-piperazin-1-yl)-phenol[27]
3- (4-Methyl-piperidin-1-ylmethyl)-1H-indole[28]
3- (4-Phenyl-piperazin-1-ylmethyl)-1H-indole[28]
3- (4-Phenyl-piperidin-1-ylmethyl)-1H-indole[28]
4- (2-Benzylamino-ethoxy)-1,3-dihydro-indol-2-one[26]
4- (4-Benzyl-piperazin-1-yl)-1H-benzoimidazole[27]
4- (4-Benzyl-piperazin-1-yl)-1H-indole[27]
4- (4-Benzyl-piperazin-1-yl)-5-chloro-1H-indole[27]
4- (4-Benzyl-piperazin-1-yl)-7-bromo-1H-indole[27]
4- (4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one[29]
4-Dipropylamino-cyclohex-1-enecarbonitrile[17]
4-ethynyl-N,N-dipropylcyclohex-3-enamine[30]
A-437203[31]
A-690344[31]
A-706149[32]
A-987306[11]
Azaperone[33]
BEFIRADOL[34]
BP-897[35]
Benzyl-[2- (1H-indazol-4-yloxy)-ethyl]-amine[26]
Benzyl-[2- (1H-indol-4-yloxy)-ethyl]-amine[26]
D-189[36]
D-190[36]
D-192[36]
D-193[36]
D-203[36]
D-210[36]
D-218[36]
D-219[36]
D-220[36]
D-237[37]
D-237[12]
D-264[37]
D-315[38]
D-366[15]
DIHYDREXIDINE[39]
Etoloxamine[16]
FLUMEZAPINE[40]
FLUTROLINE[41]
GR-218231[42]
ISOCLOZAPINE[23]
ISOLOXAPINE[43]
L-741626[44]
L-741742[45]
L-745870[46]
LE 300[47]
MAZAPERTINE[48]
N- (4-Dipropylaminobutyl)-4-biphenylcarboxamide[30]
N- (4-Propylaminobutyl)-4-biphenylcarboxamide[30]
PG-01037[49]
PNU-95666E[50]
QUINPIROLE[51]
R-226161[52]
SB-271046[53]
SPIPERONE[54]
ST-198[55]
STEPHOLIDINE[39]
UH-232[56]
[2- (1H-Benzoimidazol-4-yloxy)-ethyl]-benzyl-amine[26]
AgonistPfizer 10[8]
Pramipexole[4]
Ropinirole[5][3]
Ropinirole CR[57]
S32504[10]
Sarizotan[10]
AntagonistAS-8112[58]
AS-9705[58]
AVE-5997EF[9]
BP4.879a[9]
GSK598809[7]
GSK618334[7]
PD-157533[9]
PD-157695[9]
PD-158771[9]
PF-217830[6]
PNU-177864[9]
RGH-1756[9]
SB-277011[9]
BinderBTS-79018[9]
U-99194A[9]
MultitargetBTS-79018[9]
PD-157695[9]
PD-158771[9]
Pramipexole[4]
Ropinirole[5][3]
Sarizotan[10]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Differential distribution of D3 dopamine receptors in the brains of several mammalian species. Brain Res. 1998 Aug 3;800(2):269-74. To Reference
Ref 2N-(omega-(4-(2-methoxyphenyl)piperazin-1-yl)alkyl)carboxamides as dopamine D2 and D3 receptor ligands. J Med Chem. 2003 Aug 28;46(18):3883-99. To Reference
Ref 3Effect of dopamine receptor agonists on sensory nerve activity: possible therapeutic targets for the treatment of asthma and COPD. Br J Pharmacol. 2002 Jun;136(4):620-8. To Reference
Ref 4Antiparkinsonian medication and pathological gambling. CNS Drugs. 2008;22(5):407-16. To Reference
Ref 5The relevance of dopamine agonists in the treatment of depression. Neuropsychiatr. 2009;23(1):15-25. To Reference
Ref 6Pfizer. Product Development Pipeline. March 31 2009. To Reference
Ref 7GSK. Product Development Pipeline. February 2009. To Reference
Ref 8Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27. To Reference
Ref 9The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. To Reference
Ref 10Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. To Reference
Ref 11J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. To Reference
Ref 12J Med Chem. 2008 Dec 25;51(24):7806-19.Structurally constrained hybrid derivatives containing octahydrobenzo[g or f]quinoline moieties for dopamine D2 and D3 receptors: binding characterization at D2/D3 receptors and elucidation of a pharmacophore model. To Reference
Ref 13Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. To Reference
Ref 14J Med Chem. 1993 Oct 15;36(21):3188-96.Substituted 3-phenylpiperidines: new centrally acting dopamine autoreceptor antagonists. To Reference
Ref 15J Med Chem. 2010 Feb 11;53(3):1023-37.Development of (S)-N6-(2-(4-(isoquinolin-1-yl)piperazin-1-yl)ethyl)-N6-propyl-4,5,6,7-tetrahydrobenzo[d]-thiazole-2,6-diamine and its analogue as a D3 receptor preferring agonist: potent in vivo activity in Parkinson's disease animal models. To Reference
Ref 16J Med Chem. 2004 Aug 12;47(17):4155-8.Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 receptor selectivity. To Reference
Ref 17J Med Chem. 2000 Feb 24;43(4):756-62.Conjugated enynes as nonaromatic catechol bioisosteres: synthesis, binding experiments, and computational studies of novel dopamine receptor agonists recognizing preferentially the D(3) subtype. To Reference
Ref 18Bioorg Med Chem. 2008 Apr 1;16(7):3773-9. Epub 2008 Feb 5.Synthesis and neuropharmacological evaluation of 2-aryl- and alkylapomorphines. To Reference
Ref 19J Med Chem. 2003 Oct 9;46(21):4377-92.Molecular modeling of the three-dimensional structure of dopamine 3 (D3) subtype receptor: discovery of novel and potent D3 ligands through a hybrid pharmacophore- and structure-based database searching approach. To Reference
Ref 20Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. Epub 2006 Mar 24.Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. To Reference
Ref 21Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. Epub 2007 Jun 7.Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. To Reference
Ref 22Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6.Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. To Reference
Ref 23J Med Chem. 1982 Jul;25(7):855-8.Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. To Reference
Ref 24Bioorg. Med. Chem. Lett. 7(3):241-246 (1997) To Reference
Ref 25J Med Chem. 1988 Aug;31(8):1621-5.Dopamine autoreceptor agonists as potential antipsychotics. 1. (Aminoalkoxy)anilines. To Reference
Ref 26Bioorg Med Chem Lett. 1999 Sep 6;9(17):2593-8.New generation dopaminergic agents. 7. Heterocyclic bioisosteres that exploit the 3-OH-phenoxyethylamine D2 template. To Reference
Ref 27Bioorg Med Chem Lett. 1998 Oct 6;8(19):2675-80.New generation dopaminergic agents. 5. Heterocyclic bioisosteres that exploit the 3-OH-N1-phenylpiperazine dopaminergic template. To Reference
Ref 28J Med Chem. 1996 May 10;39(10):1941-2.3-((4-(4-Chlorophenyl)piperazin-1-yl)-methyl)-1H-pyrrolo-2,3-b-pyridine: an antagonist with high affinity and selectivity for the human dopamine D4 receptor. To Reference
Ref 29J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. To Reference
Ref 30J Med Chem. 2008 Nov 13;51(21):6829-38. Epub 2008 Oct 4.Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. To Reference
Ref 31Bioorg Med Chem Lett. 2006 Feb;16(3):490-4. Epub 2005 Nov 11.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives. To Reference
Ref 32Bioorg Med Chem Lett. 2006 Feb;16(3):658-62. Epub 2005 Nov 2.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: Quinolin(di)one and benzazepin(di)one derivatives. herve.geneste@abbott.com. To Reference
Ref 33J Med Chem. 1993 Nov 26;36(24):3929-36.Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors. To Reference
Ref 34J Med Chem. 2010 Oct 14;53(19):7167-79.Novel pyridylmethylamines as highly selective 5-HT(1A) superagonists. To Reference
Ref 35Bioorg Med Chem Lett. 2010 Sep 1;20(17):5199-202. Epub 2010 Jul 6.Synthesis and in vitro binding studies of piperazine-alkyl-naphthamides: impact of homology and sulphonamide/carboxamide bioisosteric replacement on the affinity for 5-HT1A, alpha2A, D4.2, D3 and D2L receptors. To Reference
Ref 36J Med Chem. 2008 May 22;51(10):3005-19. Epub 2008 Apr 12.Bioisosteric heterocyclic versions of 7-{[2-(4-phenyl-piperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol: identification of highly potent and selective agonists for dopamine D3 receptor with potent in vivo activity. To Reference
Ref 37Bioorg Med Chem. 2009 Jun 1;17(11):3923-33. Epub 2009 Apr 19.Investigation of various N-heterocyclic substituted piperazine versions of 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol: effect on affinity and selectivity for dopamine D3 receptor. To Reference
Ref 38Bioorg Med Chem. 2010 Aug 1;18(15):5661-74. Epub 2010 Jun 12.Further delineation of hydrophobic binding sites in dopamine D(2)/D(3) receptors for N-4 substituents on the piperazine ring of the hybrid template 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol. To Reference
Ref 39Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. Epub 2009 Aug 20.Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities? To Reference
Ref 40J Med Chem. 1982 Oct;25(10):1133-40.Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems. To Reference
Ref 41J Med Chem. 1980 Jun;23(6):635-43.Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. To Reference
Ref 42Bioorg Med Chem. 2009 Jan 15;17(2):758-66. Epub 2008 Nov 24.Design, synthesis, and binding affinities of potential positron emission tomography (PET) ligands with optimal lipophilicity for brain imaging of the dopamine D3 receptor. Part II. To Reference
Ref 43J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. To Reference
Ref 44Bioorg. Med. Chem. 18(14):5291-5300 (2010) To Reference
Ref 45J Med Chem. 1996 May 10;39(10):1943-5.5-(4-Chlorophenyl)-4-methyl-3-(1-(2-phenylethyl)piperidin-4-yl)isoxazole: a potent, selective antagonist at human cloned dopamine D4 receptors. To Reference
Ref 46Bioorg Med Chem Lett. 1999 Feb 22;9(4):585-8.Synthesis and sar of 2- and 3-substituted 7-azaindoles as potential dopamine D4 ligands. To Reference
Ref 47Bioorg Med Chem Lett. 2007 Mar 1;17(5):1399-402. Epub 2006 Dec 3.Dopamine/serotonin receptor ligands. Part 15: Oxygenation of the benz-indolo-azecine LE 300 leads to novel subnanomolar dopamine D1/D5 antagonists. To Reference
Ref 48J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. To Reference
Ref 49J Med Chem. 2007 Aug 23;50(17):4135-46. Epub 2007 Aug 2.Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3 receptor ligands: potential substance abuse therapeutic agents. To Reference
Ref 50J Med Chem. 1997 Feb 28;40(5):639-46.Synthesis and biological activities of (R)-5,6-dihydro-N,N-dimethyl-4H-imidazo[4,5,1-ij]quinolin-5-amine and its metabolites. To Reference
Ref 51J Med Chem. 2009 Nov 12;52(21):6860-70.1,1'-Disubstituted ferrocenes as molecular hinges in mono- and bivalent dopamine receptor ligands. To Reference
Ref 52Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. Epub 2007 Mar 21.Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-adrenoceptor antagonism. To Reference
Ref 53Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. To Reference
Ref 54J Med Chem. 2005 Feb 10;48(3):694-709.Modeling the similarity and divergence of dopamine D2-like receptors and identification of validated ligand-receptor complexes. To Reference
Ref 55Bioorg Med Chem. 2007 Dec 1;15(23):7258-73. Epub 2007 Aug 25.Hybrid approach for the design of highly affine and selective dopamine D(3) receptor ligands using privileged scaffolds of biogenic amine GPCR ligands. To Reference
Ref 56Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997) To Reference
Ref 57Emerging drugs for Parkinson's disease. Expert Opin Emerg Drugs. 2006 Sep;11(3):403-17. To Reference
Ref 58Emerging drugs for chemotherapy-induced emesis. Expert Opin Emerg Drugs. 2006 Mar;11(1):137-51. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543