Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00054

Target Information
NameSuccinate semialdehyde dehydrogenase, mitochondrial    
Type of targetSuccessful target    
SynonymsNAD(+)-dependent succinic semialdehyde dehydrogenase    
Succinic dehydrogenase    
DiseaseRiboflavin deficiency    [1]
Drug(s)ChlormerodrinApprovedDiagnostic tool[2]
Succinic acidApprovedDietary shortage[3][4][5]
BioChemical ClassOxidoreductases acting on the aldehyde or oxo group of donors    
EC NumberEC 1.2.1.24
PathwayAlanine, aspartate and glutamate metabolism
Butanoate metabolism
Metabolic pathways
UniProt IDP51649
SequenceMATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKER SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH TPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL AELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAF AEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFF EPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWR VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL
Target ValidationClick to Find Target Validation Information.    
Inhibitor1- (4-hydroxyphenyl)prop-2-en-1-one[6]
Chlormerodrin[2]
Succinic acid[3][4][5]
VANILLIN[6]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Altered acyl-CoA metabolism in riboflavin deficiency. Biochim Biophys Acta. 1989 Dec 18;1006(3):335-43. To Reference
Ref 2Experimental study on renal succinic dehydrogenase. 2. Age differences in renal succinic dehydrogenase in rats administered diuretics. Nippon Shonika Gakkai Zasshi. 1968 Apr 1;72(4):370-80. To Reference
Ref 3Redox-switch modulation of human SSADH by dynamic catalytic loop. EMBO J. 2009 Apr 8;28(7):959-68. Epub 2009 Mar 19. To Reference
Ref 4Succinic semialdehyde couples stress response to quorum-sensing signal decay in Agrobacterium tumefaciens. Mol Microbiol. 2006 Oct;62(1):45-56. Epub 2006 Aug 30. To Reference
Ref 5The GABA shunt: an attractive and potential therapeutic target in the treatment of epileptic disorders. Curr Drug Metab. 2005 Apr;6(2):127-39. To Reference
Ref 6Bioorg Med Chem Lett. 2006 Feb;16(3):592-5. Epub 2005 Nov 14.Inhibition of GABA shunt enzymes' activity by 4-hydroxybenzaldehyde derivatives. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543