| Target
Information |
| Name | DNA topoisomerase II |
| Type of target | Successful target |
| Synonyms | DNA gyrase |
| Topo II |
| Topoisomerase II |
| Type II topoisomerase enzyme |
| Disease | Acute promyelocytic leukemia [1] |
| Bacterial infections [2][3] |
| Cancer, unspecific [4][5][6] |
| Fungal diseases [7] |
| Herpes virus infection [8] |
| Leishmania infections [9] |
| Malaria [10] |
| Trichomoniasis [11] |
| Drug(s) | Aclarubicin |  | Approved | Cancer | [12][8] |
| Amsacrine |  | Approved | Acute lymphoblastic leukemia | [13] |
| Cinoxacin |  | Approved | Urinary tract infections | [14] |
| Ciprofloxacin |  | Approved | Bacterial infections | [15] |
| Dexrazoxane |  | Approved | Breast Cancer | [12][16] |
| Dhaq diacetate |  | Approved | Cancer | [17][6] |
| Doxorubicin |  | Approved | Cancers | [18][19] |
| Enoxacin |  | Approved | Bacterial infections | [20] |
| Epirubicin |  | Approved | Cancers | [21] |
| Etoposide |  | Approved | Cancers | [8][10][13] |
| Fleroxacin |  | Approved | Bacterial infections | [22] |
| Fluoroquinolone |  | Approved | Bacterial infections | [23] |
| Gatifloxacin |  | Approved | Respiratory tract infections | [24] |
| Gatifloxacin |  | Approved | Respiratory tract infections | [24] |
| Gemifloxacin |  | Approved | Bacterial infections | [25] |
| Idarubicin |  | Approved | Acute myeloid leukemia | [26] |
| Levofloxacin |  | Approved | Bacterial infections | [27] |
| Lomefloxacin |  | Approved | Bacterial infections | [28] |
| Lucanthone |  | Approved | Cancer | [29] |
| Mitoxantrone |  | Approved | Cancers | [30] |
| Moxifloxacin |  | Approved | Bacterial infections | [31] |
| Nalidixic Acid |  | Approved | Bacterial infections | [15] |
| Norfloxacin |  | Approved | Bacterial infections | [10][15] |
| Novobiocin |  | Approved | Bacterial infections | [32] |
| Novobiocine |  | Approved | Bacterial infections | [23] |
| Ofloxacin |  | Approved | Bacterial infections | [15] |
| Pefloxacin |  | Approved | Gonococcal urethritis in males | [20] |
| Quinolones |  | Approved | Tuberculosis | [33] |
| Rosoxacin |  | Approved | Bacterial infections | [34] |
| Sparfloxacin |  | Approved | Bacterial infections | [27] |
| Teniposide |  | Approved | Acute lymphocytic leukemia | [35] |
| Trovafloxacin |  | Approved | Bacterial infections | [36] |
| Valrubicin |  | Approved | Bladder cancer | [37] |
| ciprofloxacin |  | Approved | Bacterial infections | [38] |
| SNS-595 |  | Phase II | Ovarian cancer | [39] |
| GSK945237 |  | Phase I | Bacterial infections | [40] |
| Iboctadekin + Doxil |  | Phase I | Ovarian cancer | [40] |
| TOP-53 |  | Phase I | Lung tumors and lung metastatic tumors | [41] |
| Garenoxacin |  | Discontinued | Endocarditis | [42] |
| Salvicine |  | Preclinical | Cancers | [43] |
| BioChemical Class | Isomerases |
| EC Number | EC 5.99.1.3 |
| UniProt ID | P0AES4 |
| P0AES6 |
| P11388 |
| Q02880 |
| PDB Structure | 1LWZ; 1ZXM; 1ZXN. |
| Sequence | MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN
NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHM
WIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDK
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD
RKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE
ELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR
GYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEK
KDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA
KGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ
RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRA
ATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLE
ADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKG
TKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHM
DFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
|
| Related US Patent | 6,420,377 |
| 6,441,198 |
| 6,465,008 |
| 6,608,087 |
| 6,632,809 |
| Target Validation | Click to Find Target Validation Information. |
| QSAR Model | Click to Find Target QSAR Model. |
| Inhibitor | 1,3,7-trihydroxyacridone |  | [8] |
| 1-Methoxy-3- (oxiran-2-ylmethoxy)-9H-xanthen-9-one |  | [44] |
| 2- (2-Aminoethyl)anthra[1,9-cd]pyrazol-6 |  | [45] |
| 2- (2-Hydroxyethyl)anthra[1,9-cd]pyrazol-6 |  | [45] |
| 3,3'- (4-phenylpyridine-2,6-diyl)diphenol |  | [46] |
| 3- (2,6-diphenylpyridin-4-yl)phenol |  | [46] |
| 3- (2-phenyl-6- |  | [46] |
| 3- (2-phenyl-6- |  | [46] |
| 3- (4-phenyl-6- |  | [46] |
| 3- (4-phenyl-6- |  | [46] |
| 3- (6- |  | [46] |
| 4'-Demethyl-4beta-amino-4-desoxypodophyllotoxin |  | [47] |
| 4'-Demethyl-epipodophyllotoxin |  | [47] |
| 4,4'- (4-phenylpyridine-2,6-diyl)diphenol |  | [46] |
| 4- (furan-3-yl)-2,6-di |  | [48] |
| 7-chloro-1,3-dihydroxyacridone |  | [8] |
| A-62176 |  | [49] |
| Aclarubicin |  | [12][8] |
| Amifloxacin |  | [15] |
| Amsacrine |  | [13] |
| Anthracycline |  | [35] |
| Cinoxacin |  | [14] |
| Ciprofloxacin |  | [15] |
| Clorobiocin |  | [50] |
| Coumermycin A1 |  | [15] |
| DEMETHYLZEYLASTERONE |  | [51] |
| Dexrazoxane |  | [12][16] |
| Dhaq diacetate |  | [17][6] |
| Doxorubicin |  | [18][19] |
| ER-37328 |  | [52] |
| Ellipticine |  | [11] |
| Enoxacin |  | [20] |
| Epirubicin |  | [21] |
| Etoposide |  | [8][10][13] |
| Fleroxacin |  | [22] |
| Fluoroquinolone |  | [23] |
| Fluoroquinolones |  | [11] |
| GSK945237 |  | [40] |
| Garenoxacin |  | [42] |
| Gatifloxacin |  | [24] |
| Gatifloxacin |  | [24] |
| Gemifloxacin |  | [25] |
| Genistein |  | [53] |
| Howiinol A (GHM-10) |  | [54] |
| ICRF-154 |  | [1] |
| ICRF-193 |  | [1] |
| Iboctadekin + Doxil |  | [40] |
| Idarubicin |  | [26] |
| LOSOXANTRONE |  | [55] |
| LUPEOL |  | [56] |
| Levofloxacin |  | [27] |
| Lomefloxacin |  | [28] |
| Lucanthone |  | [29] |
| Mitoxantrone |  | [30] |
| Moxifloxacin |  | [31] |
| Nalidixic Acid |  | [15] |
| Norfloxacin |  | [10][15] |
| Novobiocin |  | [32] |
| Ofloxacin |  | [15] |
| Olean-12-en-3beta,15alpha-diol |  | [56] |
| Oxolinic acid |  | [15] |
| PIROXANTRONE |  | [55] |
| Pefloxacin |  | [20] |
| Phosphoaminophosphonic Acid-Adenylate Ester |  | [57] |
| Podophyllotoxin |  | [58] |
| Pumiliotoxin 251D |  | [59] |
| Quinolones |  | [33] |
| Ro-23-9424 |  | [59] |
| Rosoxacin |  | [34] |
| SNS-595 |  | [39] |
| Salvicine |  | [43] |
| Sparfloxacin |  | [27] |
| TOP-53 |  | [41] |
| TOPOSTATIN |  | [60] |
| Teniposide |  | [35] |
| Trovafloxacin |  | [36] |
| Valrubicin |  | [37] |
| ciprofloxacin |  | [38] |
| makaluvamine N |  | [61] |
| Binder | CBR-2092 |  | [59] |
| Ciprofloxacin+dexamethasone |  | [62] |
| Novobiocine |  | [23] |
| Ofloxacin otic |  | [62] |
| Ro-23-9424 |  | [59] |
| Toll-like receptor 4 inhibition |  | [59] |
| Multitarget | Ciprofloxacin |  | [15] |
| Gatifloxacin |  | [24] |
| Gemifloxacin |  | [25] |
| Iboctadekin + Doxil |  | [40] |
| Levofloxacin |  | [27] |
| Moxifloxacin |  | [31] |
| Sparfloxacin |  | [27] |
| Cross References |
3D Structure
Related Literature
On-Line
Medical Dictionary |
| Ref 1 | The catalytic DNA topoisomerase II inhibitor ICRF-193 and all-trans retinoic acid cooperatively induce granulocytic differentiation of acute promyelocytic leukemia cells: candidate drugs for chemo-differentiation therapy against acute promyelocytic leukemia. Exp Hematol. 2002 Nov;30(11):1273-82. To Reference |
| Ref 2 | Activity of and resistance to moxifloxacin in Staphylococcus aureus. Antimicrob Agents Chemother. 2003 Apr;47(4):1410-5. To Reference |
| Ref 3 | Inhibitory activity of NM394, the active form of prodrug prulifloxacin against type II topoisomerase from Pseudomonas aeruginosa. Jpn J Antibiot. 2002 Dec;55(6):882-5. To Reference |
| Ref 4 | Phenoxodiol (2H-1-benzopyran-7-0,1,3-(4-hydroxyphenyl)), a novel isoflavone derivative, inhibits DNA topoisomerase II by stabilizing the cleavable complex. Anticancer Res. 2002 Sep-Oct;22(5):2581-5. To Reference |
| Ref 5 | Molecular cloning and identification of a point mutation in the topoisomerase II cDNA from an etoposide-resistant Chinese hamster ovary cell line. J Biol Chem. 1993 Jan 25;268(3):2160-5. To Reference |
| Ref 6 | Topoisomerase II is required for mitoxantrone to signal nuclear factor kappa B activation in HL60 cells. J Biol Chem. 2000 Aug 18;275(33):25231-8. To Reference |
| Ref 7 | Molecular cloning and expression of the Candida albicans TOP2 gene allows study of fungal DNA topoisomerase II inhibitors in yeast. Biochem J. 1997 May 15;324 ( Pt 1):329-39. To Reference |
| Ref 8 | 1,3-Dihydroxyacridone derivatives as inhibitors of herpes virus replication. Antiviral Res. 2000 Feb;45(2):123-34. To Reference |
| Ref 9 | Cloning, functional analysis and post-transcriptional regulation of a type II DNA topoisomerase from Leishmania infantum. A new potential target for anti-parasite drugs. Nucleic Acids Res. 2003 Aug 15;31(16):4917-28. To Reference |
| Ref 10 | Gametocytocidal activity of pyronaridine and DNA topoisomerase II inhibitors against multidrug-resistant Plasmodium falciparum in vitro. Parasitol Int. 2000 Feb;48(4):275-80. To Reference |
| Ref 11 | In vitro sensitivity of Trichomonas vaginalis to DNA topoisomerase II inhibitors. Southeast Asian J Trop Med Public Health. 2000 Mar;31(1):118-22. To Reference |
| Ref 12 | Linker length in podophyllotoxin-acridine conjugates determines potency in vivo and in vitro as well as specificity against MDR cell lines. Anticancer Drug Des. 2001 Dec;16(6):305-15. To Reference |
| Ref 13 | Design of two etoposide-amsacrine conjugates: topoisomerase II and tubuline polymerization inhibition and relation to cytotoxicity. Anticancer Drug Des. 2000 Dec;15(6):413-21. To Reference |
| Ref 14 | The interaction and transport of beta-lactam antibiotics with the cloned rat renal organic anion transporter 1. J Pharmacol Exp Ther. 1999 Aug;290(2):672-7. To Reference |
| Ref 15 | Activity of fluoroquinolone antibiotics against Plasmodium falciparum in vitro. Antimicrob Agents Chemother. 1988 Aug;32(8):1182-6. To Reference |
| Ref 16 | Improved targeting of brain tumors using dexrazoxane rescue of topoisomerase II combined with supralethal doses of etoposide and teniposide. Clin Cancer Res. 1998 Jun;4(6):1367-73. To Reference |
| Ref 17 | The hypoxia-activated ProDrug AQ4N penetrates deeply in tumor tissues and complements the limited distribution of mitoxantrone. Cancer Res. 2009 Feb 1;69(3):940-7. Epub 2009 Jan 27. To Reference |
| Ref 18 | NK314, a topoisomerase II inhibitor that specifically targets the alpha isoform. J Biol Chem. 2008 Aug 29;283(35):23711-20. Epub 2008 Jul 2. To Reference |
| Ref 19 | Proteasome inhibition circumvents solid tumor resistance to topoisomerase II-directed drugs. Cancer Res. 2000 May 1;60(9):2429-34. To Reference |
| Ref 20 | Clinical pharmacokinetics of the newer antibacterial 4-quinolones. Clin Pharmacokinet. 1988 Feb;14(2):96-121. To Reference |
| Ref 21 | Topoisomerase II alpha and responsiveness of breast cancer to adjuvant chemotherapy. J Natl Cancer Inst. 2009 May 6;101(9):644-50. Epub 2009 Apr 28. To Reference |
| Ref 22 | Fleroxacin overview. Chemotherapy. 1996 Mar;42 Suppl 1:1-9. To Reference |
| Ref 23 | Has nature already identified all useful antibacterial targets? Curr Opin Microbiol. 2008 Oct;11(5):387-92. Epub 2008 Oct 6. To Reference |
| Ref 24 | Antimicrob Agents Chemother. 1998 Oct;42(10):2678-81.Inhibitory activities of gatifloxacin (AM-1155), a newly developed fluoroquinolone, against bacterial and mammalian type II topoisomerases. To Reference |
| Ref 25 | Gemifloxacin for the treatment of respiratory tract infections: in vitro susceptibility, pharmacokinetics and pharmacodynamics, clinical efficacy, and safety. Pharmacotherapy. 2005 May;25(5):717-40. To Reference |
| Ref 26 | Formation and longevity of idarubicin-induced DNA topoisomerase II cleavable complexes in K562 human leukaemia cells. Biochem Pharmacol. 2002 May 15;63(10):1807-15. To Reference |
| Ref 27 | DNA gyrase, topoisomerase IV, and the 4-quinolones. Microbiol Mol Biol Rev. 1997 Sep;61(3):377-92. To Reference |
| Ref 28 | Inhibition of human topoisomerase IIalpha by fluoroquinolones and ultraviolet A irradiation. Toxicol Sci. 2002 Sep;69(1):16-22. To Reference |
| Ref 29 | Clonogenicity of human leukemic cells protected from cell-lethal agents by heat shock protein 70. Cell Stress Chaperones. 2005 Spring;10(1):37-45. To Reference |
| Ref 30 | Acute promyelocytic leukemic involvement of the optic nerves following mitoxantrone treatment for multiple sclerosis. J Neurol Sci. 2008 Oct 15;273(1-2):144-7. Epub 2008 Aug 6. To Reference |
| Ref 31 | Quinolones as enhancers of camptothecin-induced cytotoxic and anti-topoisomerase I effects. Biochem Pharmacol. 2008 Mar 15;75(6):1272-81. Epub 2007 Dec 3. To Reference |
| Ref 32 | Transcriptional responses of Bacillus subtillis and thuringiensis to antibiotics and anti-tumour drugs. Int J Mol Med. 2009 Jan;23(1):33-9. To Reference |
| Ref 33 | Annu Rev Pharmacol Toxicol. 2005;45:529-64.The magic bullets and tuberculosis drug targets. To Reference |
| Ref 34 | Inhibition of Micrococcus luteus DNA gyrase by norfloxacin and 10 other quinolone carboxylic acids. Antimicrob Agents Chemother. 1986 Apr;29(4):598-601. To Reference |
| Ref 35 | Topoisomerases: therapeutic value. Ann Pharm Fr. 1996;54(1):40-4. To Reference |
| Ref 36 | Topoisomerase II inhibition involves characteristic chromosomal expression patterns. BMC Genomics. 2008 Jul 8;9:324. To Reference |
| Ref 37 | Metabolic activation of N-acylanthracyclines precedes their interaction with DNA topoisomerase II. NCI Monogr. 1987;(4):111-5. To Reference |
| Ref 38 | Isobolographic analysis of pharmacodynamic interactions between antifungal agents and ciprofloxacin against Candida albicans and Aspergillus fumigatus. Antimicrob Agents Chemother. 2008 Jun;52(6):2196-204. Epub 2008 Feb 25. To Reference |
| Ref 39 | Emerging drugs for ovarian cancer. Expert Opin Emerg Drugs. 2008 Sep;13(3):523-36. To Reference |
| Ref 40 | GSK. Product Development Pipeline. February 2009. To Reference |
| Ref 41 | DNA topoisomerase II as the target for the anticancer drug TOP-53: mechanistic basis for drug action. Biochemistry. 2001 Jan 23;40(3):712-8. To Reference |
| Ref 42 | The inhibition and selectivity of bacterial topoisomerases by BMS-284756 and its analogues. J Antimicrob Chemother. 2001 Aug;48(2):195-201. To Reference |
| Ref 43 | Salvicine, a novel topoisomerase II inhibitor, exerts its potent anticancer activity by ROS generation. Acta Pharmacol Sin. 2007 Sep;28(9):1460-5. To Reference |
| Ref 44 | Eur J Med Chem. 2010 Sep;45(9):4221-8. Epub 2010 Jun 17.Synthesis and pharmacological evaluation of new methyloxiranylmethoxyxanthone analogues. To Reference |
| Ref 45 | Bioorg Med Chem. 2010 Jun 1;18(11):3974-84. Epub 2010 Apr 18.Design, synthesis and biological evaluation of a novel series of anthrapyrazoles linked with netropsin-like oligopyrrole carboxamides as anticancer agents. To Reference |
| Ref 46 | Bioorg Med Chem. 2010 May 1;18(9):3066-77. Epub 2010 Mar 27.Synthesis, topoisomerase I and II inhibitory activity, cytotoxicity, and structure-activity relationship study of hydroxylated 2,4-diphenyl-6-aryl pyridines. To Reference |
| Ref 47 | J. Nat. Prod. 52(3):606-613 (1989) To Reference |
| Ref 48 | Bioorg Med Chem Lett. 2010 Jan 1;20(1):42-7. Epub 2009 Nov 14.2,6-Dithienyl-4-furyl pyridines: Synthesis, topoisomerase I and II inhibition, cytotoxicity, structure-activity relationship, and docking study. To Reference |
| Ref 49 | J Med Chem. 1998 Oct 22;41(22):4273-8.Design of new topoisomerase II inhibitors based upon a quinobenzoxazine self-assembly model. To Reference |
| Ref 50 | Tsai FT, Singh OM, Skarzynski T, Wonacott AJ, Weston S, Tucker A, Pauptit RA, Breeze AL, Poyser JP, O’Brien R, Ladbury JE, Wigley DB: The high-resolution crystal structure of a 24-kDa gyrase B fragment from E. coli complexed with one of the most potent coumarin inhibitors, clorobiocin. Proteins. 1997 May;28(1):41-52. To Reference |
| Ref 51 | J Nat Prod. 2001 Oct;64(10):1294-6.Catalytic inhibition of topoisomerase IIalpha by demethylzeylasterone, a 6-oxophenolic triterpenoid from Kokoona zeylanica. To Reference |
| Ref 52 | Antitumor activity of ER-37328, a novel carbazole topoisomerase II inhibitor. Mol Cancer Ther. 2002 Jan;1(3):169-75. To Reference |
| Ref 53 | Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference |
| Ref 54 | Anticancer effect of Howiinol A and its mechanism of action. J Asian Nat Prod Res. 1999;2(1):1-19. To Reference |
| Ref 55 | Bioorg Med Chem. 2008 Apr 1;16(7):3959-68. Epub 2008 Jan 26.The structure-based design, synthesis and biological evaluation of DNA-binding bisintercalating bisanthrapyrazole anticancer compounds. To Reference |
| Ref 56 | J Nat Prod. 2001 Dec;64(12):1545-7.Screening of triterpenoids isolated from Phyllanthus flexuosus for DNA topoisomerase inhibitory activity. To Reference |
| Ref 57 | Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference |
| Ref 58 | Antitumor properties of podophyllotoxin and related compounds. Curr Pharm Des. 2000 Dec;6(18):1811-39. To Reference |
| Ref 59 | How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30. To Reference |
| Ref 60 | J Nat Prod. 2001 Feb;64(2):204-7.Isoaurostatin, a novel topoisomerase inhibitor produced by Thermomonospora alba. To Reference |
| Ref 61 | J Nat Prod. 1997 Apr;60(4):408-10.Makaluvamine N: a new pyrroloiminoquinone from Zyzzya fuliginosa. To Reference |
| Ref 62 | Emerging therapies for the treatment and prevention of otitis media. Expert Opin Emerg Drugs. 2006 May;11(2):251-64. To Reference |