Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00086

Target Information
NameHistamine H1 receptor    
Type of targetSuccessful target    
SynonymsH1 Histamine receptor    
Histamine receptor 1    
DiseaseAcute lymphoblastic leukaemia (therapy-refractory)    [1]
Allergic diseases    [2]
Allergic rhinitis, unspecified    [3]
Anxiety disorder, unspecified    [4]
Chronic rhinitis    [5]
Chronic urticaria    [5]
Epidermal hyperplasia    [6]
Epilepsy    [7]
Hypotension    [8]
Intimal hyperplasia    [9]
Ischemia    [10]
Motion sickness    [11]
Nausea and vomiting    [12]
Seasonal allergic rhinitis    [5]
Systemic arterial vasodilation    [13]
Drug(s)(S)-(+)-Dimethindene maleateApprovedPruritus[14][15][16][10]
AceprometazineApprovedSleep disorders[17]
AcrivastineApprovedAllergic rhinitis[18][5]
AlcaftadineApprovedAllergic conjunctivitis[19]
AntazolineApprovedNasal congestion[20][21][22][5]
Antazoline hydrochlorideApprovedOcular allergies[20][21][22]
Antazoline phosphateApprovedOcular allergies[20][21][22]
AstemizoleApprovedAllergic rhinitis[23][20]
AzatadineApprovedAllergic rhinitis[24]
AzelastineApprovedAllergic conjunctivitis[25][26]
BepotastineApprovedAllergic rhinitis and uriticaria/puritus[27]
Bepotastine besilateApprovedAllergic conjunctivitis[28][29]
BromodiphenhydramineApprovedHay fever[30]
BrompheniramineApprovedAllergic rhinitis[31]
BuclizineApprovedNausea and vomiting[32]
CarbinoxamineApprovedAllergic rhinitis[33]
CetirizineApprovedAllergic rhinitis[34][35]
ChlophedianolApprovedAnesthetic[36]
ChlorpheniramineApprovedAllergic rhinitis and uriticaria[25][3][10]
CinnarizineApprovedVertigo/meniere's disease[11][37]
ClemastineApprovedAllergic rhinitis[38][39]
CyclizineApprovedNausea and vomiting[40][12][41]
CyproheptadineApprovedAllergies[42][43]
DesloratadineApprovedAllergic rhinitis[44][45]
DexbrompheniramineApprovedHay fever[46]
DimenhydrinateApprovedNausea and vomiting[47][4]
DimethindeneApprovedRespiratory allergies[14][15][16][10]
Dimethindene maleateApprovedRespiratory allergies[14][15][16][10]
DiphenhydramineApprovedVertigo/Meniere's disease[25][1]
DiphenylpyralineApprovedAllergic rhinitis[48]
DoxepinApprovedDepression[49]
DoxylamineApprovedAnxiety and morning sickness[50][51]
EmedastineApprovedAllergic conjunctivitis[52]
EpinastineApprovedAllergic conjunctivitis[53]
ErgotidineApprovedRespiratory allergies[54]
FexofenadineApprovedAllergic rhinitis[45][35]
HydroxyzineApprovedAnxiety disorder[55][56]
KetotifenApprovedAllergic conjunctivitis[25][7]
LevocabastineApprovedAllergic conjunctivitis[57][58]
Levocetirizine dihydrochlorideApprovedAllergic rhinitis[45][25][7]
LoratadineApprovedAllergies[59][60][61]
MepyramineApprovedAllergies[62][63][34]
Mepyramine maleateApprovedAllergies[62][63][34]
MequitazineApprovedAllergic rhinitis[64]
MethdilazineApprovedAllergic rhinitis[65]
MizolastineApprovedAllergic rhinitis[66]
OlopatadineApprovedAllergic conjunctivitis[67]
OxatomideApprovedHay fever[25][58]
PemirolastApprovedAllergic conjunctivitis[68]
PhenindamineApprovedCommon Cold and Allergies[69]
PheniramineApprovedHay fever[70]
PromethazineApprovedAllergic disorders, itching, nausea and vomiting[25][10]
PropiomazineApprovedInsomnia[71]
TerfenadineApprovedAllergies[72][60]
TrimeprazineApprovedAllergic rhinitis[73]
TripelennamineApprovedAsthma[74][75][76][6]
TriprolidineApprovedHay fever[77]
TranilastMarketedOcular allergy[29]
Bepotastine besilatePhase IIIOcular allergy[28][29]
CarebastinePhase IIIOcular allergy[29]
OlopatadinePhase IIIOcular allergy[29]
GSK1004723Suspended in Phase II in GSK 2009 ReportAllergic rhinitis[78]
GSK835726Suspended in Phase II in GSK 2009 ReportAllergic rhinitis[78]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayCalcium signaling pathway
Neuroactive ligand-receptor interaction
UniProt IDP35367
FunctionIn peripheral tissues, the h1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neuro.    
SequenceMSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK RILHIRS
Related US Patent6,506,756
6,509,353
6,518,287
6,525,070
6,528,522
6,605,302
6,613,357
6,649,602
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
InhibitorATC-0175[79]
DIMEBOLIN[80]
Doxepin[49]
KF-A6[81]
MDL-105212[82]
MDL-28163[82]
MIANSERIN HYDROCHLORIDE[83]
OCTOCLOTHEPIN[84]
R-226161[85]
R-dimethindene[86]
RUPATADINE[82]
SCH-37370[82]
VUF-10148[87]
Agonist8R-Lisuride[2]
Ergotidine[54]
Antagonist (S)-[14][15][16][10]
Aceprometazine[17]
Acrivastine[18][5]
Alcaftadine[19]
Antazoline[20][21][22][5]
Antazoline hydrochloride[20][21][22]
Antazoline phosphate[20][21][22]
Astemizole[23][20]
Azatadine[24]
Azelastine[25][26]
Bepotastine[27]
Bepotastine besilate[28][29]
Bromodiphenhydramine[30]
Brompheniramine[31]
Buclizine[32]
Carbinoxamine[33]
Carebastine[29]
Cetirizine[34][35]
Chlophedianol[36]
Chlorpheniramine[25][3][10]
Cinnarizine[11][37]
Clemastine[38][39]
Cyclizine[40][12][41]
Cyproheptadine[42][43]
Desloratadine[44][45]
Dexbrompheniramine[46]
Dimenhydrinate[47][4]
Dimethindene[14][15][16][10]
Dimethindene maleate[14][15][16][10]
Diphenhydramine[25][1]
Diphenylpyraline[48]
Doxylamine[50][51]
Emedastine[52]
Epinastine[53]
Fexofenadine[45][35]
GSK1004723[78]
GSK835726[78]
Hydroxyclemastine[38][39]
Hydroxyzine[55][56]
Ketotifen[25][7]
Levocabastine[57][58]
Levocetirizine dihydrochloride[45][25][7]
Loratadine[59][60][61]
Mepyramine[62][63][34]
Mepyramine maleate[62][63][34]
Mequitazine[64]
Methdilazine[65]
Mizolastine[66]
Olopatadine[67]
Olopatadine[29]
Oxatomide[25][58]
Pemirolast[68]
Phenindamine[69]
Pheniramine[70]
Promethazine[25][10]
Propiomazine[71]
Pyrilamine[25][10]
Pyrilamine Maleate[25][10]
Sch 37370[88]
Terfenadine[72][60]
Tranilast[29]
Trimeprazine[73]
Tripelennamine[74][75][76][6]
Triprolidine[77]
MultitargetGSK1004723[78]
GSK835726[78]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Histamine as an autocrine regulator of leukemic cell proliferation. Leuk Lymphoma. 2000 Jan;36(3-4):367-73. To Reference
Ref 2Mol Pharmacol. 2004 Mar;65(3):538-49.8R-lisuride is a potent stereospecific histamine H1-receptor partial agonist. To Reference
Ref 3Combined histamine H1 and H3 receptor blockade produces nasal decongestion in an experimental model of nasal congestion. Am J Rhinol. 1999 Sep-Oct;13(5):391-9. To Reference
Ref 4Mechanisms and abuse liability of the anti-histamine dimenhydrinate. Neurosci Biobehav Rev. 2002 Jan;26(1):61-7. To Reference
Ref 5Nonsedating histamine H1-receptor antagonists. Clin Pharm. 1989 May;8(5):331-44. To Reference
Ref 6Histamine H1 and H2 receptor antagonists accelerate skin barrier repair and prevent epidermal hyperplasia induced by barrier disruption in a dry environment. J Invest Dermatol. 2001 Feb;116(2):261-5. To Reference
Ref 7Influence of chronic treatment with H1 receptor antagonists on the anticonvulsant activity of antiepileptic drugs. Pol J Pharmacol. 2001 Jan-Feb;53(1):93-6. To Reference
Ref 8Hemodynamic significance of histamine synthesis and histamine H1- and H2-receptor gene expression during endotoxemia. Naunyn Schmiedebergs Arch Pharmacol. 2002 Dec;366(6):513-21. Epub 2002 Oct 29. To Reference
Ref 9Role of histamine H1 and H2 receptor antagonists in the prevention of intimal thickening. Eur J Pharmacol. 1998 Nov 27;362(1):53-9. To Reference
Ref 10Inhibition by histamine H1 receptor antagonists of endogenous glibenclamide-sensitive K+ channels in follicle-enclosed Xenopus oocytes. Eur J Pharmacol. 1994 Jan 1;266(1):99-102. To Reference
Ref 11Central effects of cinnarizine: restricted use in aircrew. Aviat Space Environ Med. 2002 Jun;73(6):570-4. To Reference
Ref 12Comparison of cyclizine and ondansetron for the prevention of postoperative nausea and vomiting in laparoscopic day-case gynaecological surgery. Anaesthesia. 2002 Jan;57(1):61-5. To Reference
Ref 13Analysis of Vancomycin in the Hindlimb Vascular Bed of the Rat. Am J Ther. 1996 Oct;3(10):681-687. To Reference
Ref 14Analytical method for simultaneously measuring ex vivo drug receptor occupancy and dissociation rate: application to (R)-dimethindene occupancy of central histamine H1 receptors. J Recept Signal Transduct Res. 2009;29(2):84-93. To Reference
Ref 15Prescription and safety of dimethindene maleate micropellet capsules in Hungary. Orv Hetil. 2004 Feb 15;145(7):327-9. To Reference
Ref 16Effects of dimethindene maleate nasal spray on the quality of life in seasonal allergic rhinitis. Rhinology. 2003 Sep;41(3):159-66. To Reference
Ref 17Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. To Reference
Ref 18Clinical pharmacology of new histamine H1 receptor antagonists. Clin Pharmacokinet. 1999 May;36(5):329-52. To Reference
Ref 19Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5. To Reference
Ref 20Histamine and the convulsive threshold or effectiveness of antiepileptic drugs. Przegl Lek. 2008;65(11):803-6. To Reference
Ref 21Influence of antazoline and ketotifen on the anticonvulsant activity of conventional antiepileptics against maximal electroshock in mice. Eur Neuropsychopharmacol. 2004 Aug;14(4):307-18. To Reference
Ref 22A current appreciation of sites for pharmacological intervention in allergic conjunctivitis: effects of new topical ocular drugs. Acta Ophthalmol Scand Suppl. 1999;(228):33-7. To Reference
Ref 23Histamine H1 receptor induces cytosolic calcium increase and aquaporin translocation in human salivary gland cells. J Pharmacol Exp Ther. 2009 Aug;330(2):403-12. Epub 2009 May 14. To Reference
Ref 24Comparative effects of loratadine and azatadine in the treatment of seasonal allergic rhinitis. Asian Pac J Allergy Immunol. 1990 Dec;8(2):103-7. To Reference
Ref 25Intact cell binding for in vitro prediction of sedative and non-sedative histamine H1-receptor antagonists based on receptor internalization. J Pharmacol Sci. 2008 May;107(1):66-79. Epub 2008 Apr 29. To Reference
Ref 26The in vivo potency and selectivity of azelastine as an H1 histamine-receptor antagonist in human airways and skin. J Allergy Clin Immunol. 1988 Dec;82(6):1113-8. To Reference
Ref 27Mast cells play a critical role in the pathogenesis of viral myocarditis. Circulation. 2008 Jul 22;118(4):363-72. Epub 2008 Jul 7. To Reference
Ref 28Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92. To Reference
Ref 29Emerging drugs for ocular allergy. Expert Opin Emerg Drugs. 2005 Aug;10(3):505-20. To Reference
Ref 30Studies on synergism between penicillins and ambodryl (bromodiphenhydramine HCl), an antihistamine with antimicrobial property. Indian J Exp Biol. 1990 Mar;28(3):253-8. To Reference
Ref 31Histamine-induced venodilation in human beings involves both H1 and H2 receptor subtypes. J Allergy Clin Immunol. 1994 Mar;93(3):606-14. To Reference
Ref 32Toxicologic and clinical appraisal of buclizine, a new antihistaminic compound. J Allergy. 1956 Jan;27(1):63-7. To Reference
Ref 33Comparison of the effects of eleven histamine H1-receptor antagonists on monoamine turnover in the mouse brain. Naunyn Schmiedebergs Arch Pharmacol. 1994 Feb;349(2):140-4. To Reference
Ref 34Design, synthesis and histamine H1-receptor antagonistic activity of some novel 4-amino-2-(substituted)-5-(substituted) aryl-6-[(substituted aryl) amino] pyrimidines. Arzneimittelforschung. 2009;59(5):243-7. To Reference
Ref 35Nat Rev Drug Discov. 2003 Jan;2(1):38-51.Knockouts model the 100 best-selling drugs--will they model the next 100? To Reference
Ref 36Identification and differentiation of alkylamine antihistamines and their metabolites in urine by computerized gas chromatography-mass spectrometry. J Chromatogr. 1988 Aug 19;430(1):31-41. To Reference
Ref 37Effects of calcium-antagonistic drugs on the stimulation by carbamoylcholine and histamine of phosphatidylinositol turnover in longitudinal smooth muscle of guinea-pig ileum. Biochem J. 1976 Nov 15;160(2):163-9. To Reference
Ref 38Histamine upregulates keratinocyte MMP-9 production via the histamine H1 receptor. J Invest Dermatol. 2008 Dec;128(12):2783-91. Epub 2008 Jun 12. To Reference
Ref 39Stereoselective synthesis of (-)-hydroxyclemastine as a versatile intermediate for the H1 receptor antagonist clemastine. Arch Pharm Res. 2007 Dec;30(12):1521-5. To Reference
Ref 40Histamine H1-receptor antagonists, promethazine and homochlorcyclizine, increase the steady-state plasma concentrations of haloperidol and reduced haloperidol. Ther Drug Monit. 2003 Apr;25(2):192-6. To Reference
Ref 41Synthesis and combined H1-/H2 antagonist activity of mepyramine, pheniramine and cyclizine derivatives with cyanoguanidine, urea and nitroethenediamine partial structures. Arch Pharm (Weinheim). 1994 Jul;327(7):455-62. To Reference
Ref 42Cyproheptadine displays preclinical activity in myeloma and leukemia. Blood. 2008 Aug 1;112(3):760-9. Epub 2008 May 23. To Reference
Ref 43Antihistamines in the treatment of dermatitis. J Cutan Med Surg. 2003 Nov-Dec;7(6):467-73. To Reference
Ref 44Examining the tolerability of the non-sedating antihistamine desloratadine: a prescription-event monitoring study in England. Drug Saf. 2009;32(2):169-79. doi: 10.2165/00002018-200932020-00009. To Reference
Ref 45Update on prescription and over-the-counter histamine inverse agonists in rhinitis therapy. Curr Allergy Asthma Rep. 2009 Mar;9(2):140-8. To Reference
Ref 46H2 histaminergic control of inhibition of eating induced by intragastric NaCl in rats. Physiol Behav. 1998 Aug;65(1):105-13. To Reference
Ref 47Histamine 1 receptor antagonist in symptomatic treatment of renal colic accompanied by nausea: two birds with one stone? Urology. 2009 Jan;73(1):32-6. Epub 2008 Oct 11. To Reference
Ref 48Transport mechanism of an H1-antagonist at the blood-brain barrier: transport mechanism of mepyramine using the carotid injection technique. Biol Pharm Bull. 1994 May;17(5):676-9. To Reference
Ref 49Novel therapeutic usage of low-dose doxepin hydrochloride. Expert Opin Investig Drugs. 2007 Aug;16(8):1295-305. To Reference
Ref 50First-generation H1 antihistamines found in pilot fatalities of civil aviation accidents, 1990-2005. Aviat Space Environ Med. 2007 May;78(5):514-22. To Reference
Ref 51Steady-state brain concentrations of antihistamines in rats: interplay of membrane permeability, P-glycoprotein efflux and plasma protein binding. Pharmacology. 2004 Oct;72(2):92-8. To Reference
Ref 52Emedastine difumarate: a review of its potential ameliorating effect for tissue remodeling in allergic diseases. Expert Opin Pharmacother. 2009 Aug;10(11):1859-67. To Reference
Ref 53Influence of epinastine hydrochloride, an H1-receptor antagonist, on the function of mite allergen-pulsed murine bone marrow-derived dendritic cells in vitro and in vivo. Mediators Inflamm. 2009;2009:738038. Epub 2009 Apr 9. To Reference
Ref 54Cloning and pharmacological characterization of a fourth histamine receptor (H(4)) expressed in bone marrow. Mol Pharmacol. 2001 Mar;59(3):420-6. To Reference
Ref 55Hydroxyzine, a first generation H(1)-receptor antagonist, inhibits human ether-a-go-go-related gene (HERG) current and causes syncope in a patient with the HERG mutation. J Pharmacol Sci. 2008 Dec;108(4):462-71. Epub 2008 Dec 5. To Reference
Ref 56Physicochemical, pharmacological and pharmacokinetic properties of the zwitterionic antihistamines cetirizine and levocetirizine. Curr Med Chem. 2008;15(21):2173-91. To Reference
Ref 57Contribution of alpha4beta1 integrin to the antiallergic effect of levocabastine. Biochem Pharmacol. 2008 Sep 15;76(6):751-62. Epub 2008 Jul 15. To Reference
Ref 58Effects of fexofenadine and other antihistamines on components of the allergic response: adhesion molecules. J Allergy Clin Immunol. 2003 Oct;112(4 Suppl):S78-82. To Reference
Ref 59Clinical research of Ibudilast on treating the steroid resistant allergic rhinitis. Lin Chung Er Bi Yan Hou Tou Jing Wai Ke Za Zhi. 2009 Jan;23(2):63-6. To Reference
Ref 60Second-generation antihistamines: a comparative review. Drugs. 1999 Jan;57(1):31-47. To Reference
Ref 61Effect of descarboethoxyloratadine, the major metabolite of loratadine, on the human cardiac potassium channel Kv1.5. Br J Pharmacol. 1997 Nov;122(5):796-8. To Reference
Ref 62Antinociception induced by central administration of histamine in the formalin test in rats. Indian J Physiol Pharmacol. 2008 Jul-Sep;52(3):249-54. To Reference
Ref 63Receptor mediation and nociceptin inhibition of bradykinin-induced plasma extravasation in the knee joint of the rat. Inflamm Res. 2009 Jun 21. [Epub ahead of print] To Reference
Ref 64Efficiency of mequitazine in the treatment of allergic rhinitis and chronic urticaria in children. A bibliographic systematic review. Rev Alerg Mex. 2008 Jan-Feb;55(1):3-9. To Reference
Ref 65Effect of H1 blockers alone and in combination with morphine to produce antinociception in mice. Neuropharmacology. 1985 Jan;24(1):1-4. To Reference
Ref 66Histamine H1-receptor antagonists inhibit nuclear factor-kappaB and activator protein-1 activities via H1-receptor-dependent and -independent mechanisms. Clin Exp Allergy. 2008 Jun;38(6):947-56. To Reference
Ref 67Pharmacokinetics of orally administered single- and multiple-dose olopatadine in healthy Chinese subjects: an open-label study. Clin Drug Investig. 2009;29(7):451-7. doi: 10.2165/00044011-200929070-00003. To Reference
Ref 68The effect of a combined therapy with a histamine H1 antagonist and a chemical mediator release inhibitor on allergic conjunctivitis. Ophthalmologica. 2008;222(4):232-9. Epub 2008 May 8. To Reference
Ref 69The histamine H1-receptor antagonist binding site. A stereoselective pharmacophoric model based upon (semi-)rigid H1-antagonists and including a known interaction site on the receptor. J Med Chem. 1995 Aug 18;38(17):3351-60. To Reference
Ref 70Role of central histaminergic system in lorazepam withdrawal syndrome in rats. Pharmacol Biochem Behav. 2001 Apr;68(4):777-82. To Reference
Ref 71How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 72Small mouse cholangiocytes proliferate in response to H1 histamine receptor stimulation by activation of the IP3/CaMK I/CREB pathway. Am J Physiol Cell Physiol. 2008 Aug;295(2):C499-513. Epub 2008 May 28. To Reference
Ref 73Effectiveness of alimemazine in controlling retching after Nissen fundoplication. J Pediatr Surg. 2005 Nov;40(11):1737-40. To Reference
Ref 74Involvement of histamine H1 and H2 receptors in the regulation of STAT-1 phosphorylation: inverse agonism exhibited by the receptor antagonists. Int Immunopharmacol. 2005 Jul;5(7-8):1299-309. To Reference
Ref 75Role of N-methyl-D-aspartate receptors in gastric mucosal blood flow induced by histamine. J Neurosci Res. 2004 Sep 1;77(5):730-8. To Reference
Ref 76Prostaglandin E2 aggravates gastric mucosal injury induced by histamine in rats through EP1 receptors. Life Sci. 2003 Dec 19;74(5):629-41. To Reference
Ref 77Histamine excites rat lateral vestibular nuclear neurons through activation of post-synaptic H2 receptors. Neurosci Lett. 2008 Dec 19;448(1):15-9. Epub 2008 Oct 14. To Reference
Ref 78GSK. Product Development Pipeline. February 2009. To Reference
Ref 79Bioorg Med Chem Lett. 2009 Nov 1;19(21):6166-71. Epub 2009 Sep 6.Pyrimidine-based antagonists of h-MCH-R1 derived from ATC0175: in vitro profiling and in vivo evaluation. To Reference
Ref 80Bioorg Med Chem Lett. 2010 Jan 1;20(1):78-82. Epub 2009 Nov 14.Synthesis and biological activity of 5-styryl and 5-phenethyl-substituted 2,3,4,5-tetrahydro-1H-pyrido[4,3-b]indoles. To Reference
Ref 81Antimicrob Agents Chemother. 2007 Nov;51(11):4133-40. Epub 2007 Sep 10.Design, synthesis, and evaluation of 10-N-substituted acridones as novel chemosensitizers in Plasmodium falciparum. To Reference
Ref 82J Med Chem. 2005 Oct 20;48(21):6523-43.Designed multiple ligands. An emerging drug discovery paradigm. To Reference
Ref 83J Med Chem. 1983 Aug;26(8):1116-22.Synthesis and biological properties of thiophene ring analogues of mianserin. To Reference
Ref 84J Med Chem. 2010 Oct 14;53(19):7021-34.Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for (1)-adrenoceptors. To Reference
Ref 85Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. Epub 2007 Mar 21.Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-adrenoceptor antagonism. To Reference
Ref 86J Med Chem. 2009 Sep 10;52(17):5307-10.Characterization of novel selective H1-antihistamines for clinical evaluation in the treatment of insomnia. To Reference
Ref 87J Med Chem. 2008 Apr 24;51(8):2457-67. Epub 2008 Mar 22.Fragment based design of new H4 receptor-ligands with anti-inflammatory properties in vivo. To Reference
Ref 88Differential plasma duration of antiplatelet-activating factor and antihistamine activities of oral Sch 37370 in humans. Clin Pharmacol Ther. 1992 Aug;52(2):151-9. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543