Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00099

Target Information
Name5-hydroxytryptamine 1B receptor    
Type of targetSuccessful target    
Synonyms5-HT-1B    
5-HT-1D-beta    
5-HT1B receptor    
S12    
Serotonin 1D beta receptor    
Serotonin receptor    
Serotonin receptor 1B    
DiseaseAnxiety disorder, unspecified    [1]
Migraine    [2]
Obsessive-compulsive disorder    [3]
Pulmonary hypertension    [4]
Drug(s)AlmotriptanApprovedAcute migraine headache[5]
EletriptanApprovedMigraine[6][7]
FrovatriptanApprovedMigraine headaches[8]
NaratriptanApprovedMigraine headaches[9]
ZolmitriptanApprovedMigraine[10]
Fluphenazine DecanoatePhase IIPsoriasis[11]
Elzasonan hydrochlorideDiscontinued in Phase IISevere Mood Disorders[12]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayNeuroactive ligand-receptor interaction
UniProt IDP28222
PDB Structure2G1X.    
FunctionThis is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase.    
SequenceMEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Related US Patent6,277,853
6,346,622
6,509,340
6,589,953
Target ValidationClick to Find Target Validation Information.    
Inhibitor (+/-)-nantenine[13]
1- (3-[14]
1- (7-Methoxy-naphthalen-2-yl)-piperazine[15]
1-Naphthalen-2-yl-piperazine[15]
2- (5-Thiophen-2-yl-1H-indol-3-yl)-ethylamine[16]
5-Ethyl-3- (2-pyrrolidin-1-yl-ethyl)-1H-indole[17]
5-Isopropyl-3- (2-pyrrolidin-1-yl-ethyl)-1H-indole[17]
5-amino-3- (N-methylpiperidin-4-yl)-1H-indole[18]
A-987306[19]
GR-127935[20]
L-747201[21]
L-775606[21]
LY-334370[18]
SB-224289[20]
SEROTONIN[19]
WAY-466[22]
[2- (5-Ethyl-1H-indol-3-yl)-ethyl]-dimethyl-amine[17]
AgonistAlmotriptan[5]
CP-94,253[1]
Eletriptan[6][7]
Frovatriptan[8]
Naratriptan[9]
SB 236057-A[23]
Zolmitriptan[10]
AntagonistElzasonan hydrochloride[12]
Fluphenazine Decanoate[11]
GR55562[4]
SB 224289[4]
MultitargetEletriptan[6][7]
Elzasonan hydrochloride[12]
Fluphenazine Decanoate[11]
Frovatriptan[8]
Zolmitriptan[10]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Anxiogenic-like effect of serotonin(1B) receptor stimulation in the rat elevated plus-maze. Pharmacol Biochem Behav. 2002 Apr;71(4):581-7. To Reference
Ref 25-Hydroxytryptamine(1F) receptors do not participate in vasoconstriction: lack of vasoconstriction to LY344864, a selective serotonin(1F) receptor agonist in rabbit saphenous vein. J Pharmacol Exp Ther. 1999 Sep;290(3):935-9. To Reference
Ref 35-HT 1B/D receptor antagonists. Gen Pharmacol. 1997 Sep;29(3):293-303. To Reference
Ref 45-hydroxytryptamine receptors mediating contraction in human small muscular pulmonary arteries: importance of the 5-HT1B receptor. Br J Pharmacol. 1999 Oct;128(3):730-4. To Reference
Ref 5Disposition and metabolism of almotriptan in rats, dogs and monkeys. Xenobiotica. 2006 Sep;36(9):807-23. To Reference
Ref 6Spotlight on eletriptan in migraine. CNS Drugs. 2006;20(11):961-4. To Reference
Ref 7Eletriptan: a review of its use in the acute treatment of migraine. Drugs. 2006;66(8):1129-49. To Reference
Ref 8Frovatriptan for the acute treatment of migraine and prevention of predictable menstrual migraine. Expert Rev Neurother. 2008 May;8(5):723-36. To Reference
Ref 9Triptans in pregnancy. Ther Drug Monit. 2008 Feb;30(1):5-9. To Reference
Ref 10Clinical pharmacology of the serotonin receptor agonist, zolmitriptan. Expert Opin Drug Metab Toxicol. 2007 Dec;3(6):899-911. To Reference
Ref 11Emerging drugs for psoriasis. Expert Opin Emerg Drugs. 2009 Mar;14(1):145-63. To Reference
Ref 12Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. To Reference
Ref 13Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. To Reference
Ref 14Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. Epub 2007 Aug 15.The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. To Reference
Ref 15J Med Chem. 1997 Nov 21;40(24):3974-8.5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. To Reference
Ref 16Bioorg Med Chem Lett. 2000 May 1;10(9):903-5.5-Thienyltryptamine derivatives as serotonin 5-HT1B/1D receptor agonists: potential treatments for migraine. To Reference
Ref 17Bioorg Med Chem Lett. 2000 Aug 7;10(15):1707-9.5-Alkyltryptamine derivatives as highly selective and potent 5-HT1D receptor agonists. To Reference
Ref 18J Med Chem. 2008 Jun 26;51(12):3609-16. Epub 2008 May 29.Designing selective, high affinity ligands of 5-HT1D receptor by covalent dimerization of 5-HT1F ligands derived from 4-fluoro-N-[3-(1-methyl-4-piperidinyl)-1H-indol-5-yl]benzamide. To Reference
Ref 19J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. To Reference
Ref 20Bioorg Med Chem Lett. 2005 Nov 1;15(21):4786-9.Synthesis of potent and selective serotonin 5-HT1B receptor ligands. To Reference
Ref 21J Med Chem. 1997 Oct 24;40(22):3501-3.Selective, orally active 5-HT1D receptor agonists as potential antimigraine agents. To Reference
Ref 22J Med Chem. 2005 Jan 27;48(2):353-6.Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. To Reference
Ref 23SB-236057-A: a selective 5-HT1B receptor inverse agonist. CNS Drug Rev. 2001 Winter;7(4):433-44. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543