Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00107

Target Information
Name5-hydroxytryptamine 4 receptor    
Type of targetSuccessful target    
Synonyms5-HT-4    
5-HT4    
5-HT4 receptor    
Serotonin receptor    
Serotonin receptor 4    
DiseaseAlzheimer's disease    [1]
Cardiac arrhythmias    [2]
Dementia    [3]
Diarrhoea-predominant irritable bowel syndrome    [2]
Drug dependence    [4]
Irritable bowel syndrome    [5]
Psychiatric illness    [4]
Drug(s)CisaprideApprovedGastroesophageal reflux disease[6][7]
TegaserodApprovedIrritable bowel syndrome[8]
RenzapridePhase III completedIrritable bowel syndrome[8]
TegaserodPhase IIIDyspepsia[8]
Fluphenazine DecanoatePhase IIPsoriasis[9]
PumosetragPhase IIIrritable bowel syndrome[8]
TegaserodPhase IIGastro-oesophagal reflux[8]
PumosetragPhase IGastro-oesophageal reflux[8]
5-HT4/D2 antagonistsNo development reportedSchizophrenia[10]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayCalcium signaling pathway
Neuroactive ligand-receptor interaction
UniProt IDQ13639
FunctionThis is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulates adenylate cyclase.    
SequenceMDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD AVECGGQWESQCHPPATSPLVAAQPSDT
Target ValidationClick to Find Target Validation Information.    
Inhibitor1- ([11]
4- (4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one[12]
BARETTIN[13]
GR-113808[14]
ML-10302[15]
Norcisapride[16]
SB-207710[17]
SEROTONIN[13]
AgonistCisapride[6][7]
HTF 919[18]
Mosapride[19]
Prucalopride[5]
Pumosetrag[8]
R0-93877[5]
Renzapride[8]
SL65.0155[3]
TD-5108[19][7]
Tegaserod[8]
Antagonist5-HT4/D2 antagonists[10]
Fluphenazine Decanoate[9]
Piboserod[5]
SB 203186[18]
SB-207266A[5]
SDZ 205,557[4]
MultitargetFluphenazine Decanoate[9]
Renzapride[8]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1The serotonin 5-HT4 receptor and the amyloid precursor protein processing. Exp Gerontol. 2003 Jan-Feb;38(1-2):159-66. To Reference
Ref 2Agonist-like activity of antibodies directed against the second extracellular loop of the human cardiac serotonin 5-HT4(e) receptor in transfected COS-7 cells. Receptors Channels. 2002;8(2):113-21. To Reference
Ref 3SL65.0155, a novel 5-hydroxytryptamine(4) receptor partial agonist with potent cognition-enhancing properties. J Pharmacol Exp Ther. 2002 Aug;302(2):731-41. To Reference
Ref 4Antagonism of 5-hydroxytryptamine(4) receptors attenuates hyperactivity induced by cocaine: putative role for 5-hydroxytryptamine(4) receptors in the nucleus accumbens shell. J Pharmacol Exp Ther. 1999 Oct;291(1):300-7. To Reference
Ref 5Irritable bowel syndrome: new agents targeting serotonin receptor subtypes. Drugs. 2001;61(3):317-32. To Reference
Ref 6Metoclopramide stimulates catecholamine- and granin-derived peptide secretion from pheochromocytoma cells through activation of serotonin type 4 (5-HT4) receptors. Endocr Relat Cancer. 2009 Mar;16(1):281-90. Epub 2008 Oct 23. To Reference
Ref 7The in vivo gastrointestinal activity of TD-5108, a selective 5-HT(4) receptor agonist with high intrinsic activity. Naunyn Schmiedebergs Arch Pharmacol. 2008 Jul;378(1):139-47. Epub 2008 Apr 12. To Reference
Ref 8Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. To Reference
Ref 9Emerging drugs for psoriasis. Expert Opin Emerg Drugs. 2009 Mar;14(1):145-63. To Reference
Ref 10The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. To Reference
Ref 11J Med Chem. 2006 Jan 12;49(1):318-28.1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. To Reference
Ref 12J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. To Reference
Ref 13J Nat Prod. 2006 Oct;69(10):1421-4.Brominated cyclodipeptides from the marine sponge Geodia barretti as selective 5-HT ligands. To Reference
Ref 14J Med Chem. 2007 Sep 6;50(18):4482-92. Epub 2007 Aug 3.Synthesis of specific bivalent probes that functionally interact with 5-HT(4) receptor dimers. To Reference
Ref 15J Med Chem. 2009 Apr 23;52(8):2214-25.Design, synthesis, and biological evaluation of new 5-HT4 receptor agonists: application as amyloid cascade modulators and potential therapeutic utility in Alzheimer's disease. To Reference
Ref 16Bioorg Med Chem Lett. 2009 Oct 1;19(19):5679-83. Epub 2009 Aug 8.mu-Opioid/5-HT4 dual pharmacologically active agents-efforts towards an effective opioid analgesic with less GI and respiratory side effects (Part I). To Reference
Ref 17J Med Chem. 2010 Oct 14;53(19):7035-47.Synthesis, structure-affinity relationships, and radiolabeling of selective high-affinity 5-HT4 receptor ligands as prospective imaging probes for positron emission tomography. To Reference
Ref 185-Hydroxytryptamine mediated contractions in isolated preparations of equine ileum and pelvic flexure: pharmacological characterization of a new 5-HT(4) agonist. J Vet Pharmacol Ther. 2002 Feb;25(1):49-58. To Reference
Ref 19The in vitro pharmacological profile of TD-5108, a selective 5-HT(4) receptor agonist with high intrinsic activity. Naunyn Schmiedebergs Arch Pharmacol. 2008 Jul;378(1):125-37. Epub 2008 Apr 16. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543