Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00118

Target Information
NameSynaptic vesicle amine transporter    
Type of targetSuccessful target    
SynonymsMonoamine transporter    
Solute carrier family 18 member 2    
VAT    
VMAT    
Vesicular Monoamine Transporter    
Vesicular amine transporter    
DiseaseCocaine dependence    [1]
Neurodegenerative diseases    [1]
Drug(s)AlseroxylonApprovedHypertension[2]
ReserpineApprovedHypertension[3]
TetrabenazineApprovedHyperkinetic movement disorder[3][4]
BioChemical ClassTransmembrane protein    
PathwayParkinson's disease
UniProt IDQ05940
FunctionInvolved in the atp-dependent vesicular transport of biogenic amine neurotransmitters. pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion.    
SequenceMALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Target ValidationClick to Find Target Validation Information.    
InhibitorLobeline[5]
Reserpine[5]
Tetrabenazine[5]
Antagonist3,4-Methylenedioxymethamphetamine[6]
4-Methoxyamphetamine[7]
MMDA[8]
BlockerAlseroxylon[2]
Reserpine[3]
Tetrabenazine[3][4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1PET studies of brain monoamine transporters. Curr Pharm Des. 2000 Nov;6(16):1611-23. To Reference
Ref 2Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. To Reference
Ref 3Dopamine signaling is required for depolarization-induced slow current in cerebellar Purkinje cells. J Neurosci. 2009 Jul 1;29(26):8530-8. To Reference
Ref 411C-dihydrotetrabenazine PET of the pancreas in subjects with long-standing type 1 diabetes and in healthy controls. J Nucl Med. 2009 Mar;50(3):382-9. Epub 2009 Feb 17. To Reference
Ref 521050177 To Reference
Ref 6Freudenmann RW, Oxler F, Bernschneider-Reif S: The origin of MDMA (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5. To Reference
Ref 7Daws LC, Irvine RJ, Callaghan PD, Toop NP, White JM, Bochner F: Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. To Reference
Ref 8Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543