TTD Target ID: TTDS00118

Target Information
Name	Synaptic vesicle amine transporter
Type of target	Successful target
Synonyms	Monoamine transporter
	Solute carrier family 18 member 2
	VAT
	VMAT
	Vesicular Monoamine Transporter
	Vesicular amine transporter
Disease	Cocaine dependence    [1]
	Neurodegenerative diseases    [1]
Drug(s)	Alseroxylon		Approved	Hypertension	[2]
	Reserpine		Approved	Hypertension	[3]
	Tetrabenazine		Approved	Hyperkinetic movement disorder	[3][4]
BioChemical Class	Transmembrane protein
Pathway	Parkinson's disease
UniProt ID	Q05940
Function	Involved in the atp-dependent vesicular transport of biogenic amine neurotransmitters. pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion.
Sequence	MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Target Validation	Click to Find Target Validation Information.
Inhibitor	Lobeline		[5]
	Reserpine		[5]
	Tetrabenazine		[5]
Antagonist	3,4-Methylenedioxymethamphetamine		[6]
	4-Methoxyamphetamine		[7]
	MMDA		[8]
Blocker	Alseroxylon		[2]
	Reserpine		[3]
	Tetrabenazine		[3][4]
Cross References	3D Structure Related Literature On-Line Medical Dictionary
Ref 1	PET studies of brain monoamine transporters. Curr Pharm Des. 2000 Nov;6(16):1611-23. To Reference
Ref 2	Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. To Reference
Ref 3	Dopamine signaling is required for depolarization-induced slow current in cerebellar Purkinje cells. J Neurosci. 2009 Jul 1;29(26):8530-8. To Reference
Ref 4	11C-dihydrotetrabenazine PET of the pancreas in subjects with long-standing type 1 diabetes and in healthy controls. J Nucl Med. 2009 Mar;50(3):382-9. Epub 2009 Feb 17. To Reference
Ref 5	21050177 To Reference
Ref 6	Freudenmann RW, Oxler F, Bernschneider-Reif S: The origin of MDMA (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5. To Reference
Ref 7	Daws LC, Irvine RJ, Callaghan PD, Toop NP, White JM, Bochner F: Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. To Reference
Ref 8	Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.

Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore

All rights reserved.