TTD Target ID: TTDS00169

Target Information
Name	Prostaglandin F2-alpha receptor
Type of target	Successful target
Synonyms	FP prostaglandin receptor
	FP prostanoid receptor
	PGF receptor
	PGF2 alpha receptor
	Prostanoid FP receptor
Disease	Bone disorders    [1]
	Dysmenorrhea, unspecified    [2]
	Glaucoma    [3]
	Inflammatory diseases    [1]
	Ocular hypertension    [2]
Drug(s)	Bimatoprost		Approved	Open-angle glaucoma and ocular hypertension	[4]
	Latanoprost		Approved	Open-angle glaucoma and ocular hypertension	[5]
	Travoprost		Approved	Open-angle glaucoma and ocular hypertension	[6]
BioChemical Class	G-protein coupled receptor (rhodopsin family)
Pathway	Calcium signaling pathway
	Neuroactive ligand-receptor interaction
UniProt ID	P43088
Function	Receptor for prostaglandin f2-alpha (pgf2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum (by similarity).
Sequence	MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
Related US Patent	6,300,312
	6,342,524
	6,369,089
	6,407,250
	6,444,840
	6,509,364
	6,511,999
	6,646,001
	6,649,655
Target Validation	Click to Find Target Validation Information.
Inhibitor	AL- 16082		[7]
	DINOPROST		[7]
	LAROPIPRANT		[8]
Agonist	Bimatoprost		[4]
	Latanoprost		[5]
	Travoprost		[6]
Cross References	3D Structure Related Literature On-Line Medical Dictionary
Ref 1	Cystoid macular edema in a pseudophakic patient after switching from latanoprost to BAK-free travoprost. J Ocul Pharmacol Ther. 2007 Dec;23(6):567-70. To Reference
Ref 2	Three-month, randomized, parallel-group comparison of brimonidine-timolol versus dorzolamide-timolol fixed-combination therapy. Curr Med Res Opin. 2009 Jul;25(7):1645-53. To Reference
Ref 3	Reporting of noninferiority and equivalence randomized trials for major prostaglandins: A systematic survey of the ophthalmology literature. Trials. 2008 Dec 3;9:69. To Reference
Ref 4	Skin pigmentation after NB-UVB and three analogues of prostaglandin F(2alpha) in guinea pigs: a comparative study. J Eur Acad Dermatol Venereol. 2009 Jul 13. [Epub ahead of print] To Reference
Ref 5	PGF(2alpha) FP Receptor Contributes to Brain Damage Following Transient Focal Brain Ischemia. Neurotox Res. 2009 Jan;15(1):62-70. Epub 2009 Feb 11. To Reference
Ref 6	Prostaglandin subtype-selective and non-selective IOP-lowering comparison in monkeys. J Ocul Pharmacol Ther. 2009 Feb;25(1):1-8. To Reference
Ref 7	Bioorg Med Chem. 2009 Jan 15;17(2):576-84. Epub 2008 Dec 6.Discovery of 13-oxa prostaglandin analogs as antiglaucoma agents: synthesis and biological activity. To Reference
Ref 8	J Med Chem. 2007 Feb 22;50(4):794-806.Discovery of a potent and selective prostaglandin D2 receptor antagonist, [(3R)-4-(4-chloro-benzyl)-7-fluoro-5-(methylsulfonyl)-1,2,3,4-tetrahydrocyclopenta[b]indol-3-yl]-acetic acid (MK-0524). To Reference

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.

Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore

All rights reserved.