Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00169

Target Information
NameProstaglandin F2-alpha receptor    
Type of targetSuccessful target    
SynonymsFP prostaglandin receptor    
FP prostanoid receptor    
PGF receptor    
PGF2 alpha receptor    
Prostanoid FP receptor    
DiseaseBone disorders    [1]
Dysmenorrhea, unspecified    [2]
Glaucoma    [3]
Inflammatory diseases    [1]
Ocular hypertension    [2]
Drug(s)BimatoprostApprovedOpen-angle glaucoma and ocular hypertension[4]
LatanoprostApprovedOpen-angle glaucoma and ocular hypertension[5]
TravoprostApprovedOpen-angle glaucoma and ocular hypertension[6]
BioChemical ClassG-protein coupled receptor (rhodopsin family)    
PathwayCalcium signaling pathway
Neuroactive ligand-receptor interaction
UniProt IDP43088
FunctionReceptor for prostaglandin f2-alpha (pgf2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum (by similarity).    
SequenceMSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
Related US Patent6,300,312
6,342,524
6,369,089
6,407,250
6,444,840
6,509,364
6,511,999
6,646,001
6,649,655
Target ValidationClick to Find Target Validation Information.    
InhibitorAL- 16082[7]
DINOPROST[7]
LAROPIPRANT[8]
AgonistBimatoprost[4]
Latanoprost[5]
Travoprost[6]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Cystoid macular edema in a pseudophakic patient after switching from latanoprost to BAK-free travoprost. J Ocul Pharmacol Ther. 2007 Dec;23(6):567-70. To Reference
Ref 2Three-month, randomized, parallel-group comparison of brimonidine-timolol versus dorzolamide-timolol fixed-combination therapy. Curr Med Res Opin. 2009 Jul;25(7):1645-53. To Reference
Ref 3Reporting of noninferiority and equivalence randomized trials for major prostaglandins: A systematic survey of the ophthalmology literature. Trials. 2008 Dec 3;9:69. To Reference
Ref 4Skin pigmentation after NB-UVB and three analogues of prostaglandin F(2alpha) in guinea pigs: a comparative study. J Eur Acad Dermatol Venereol. 2009 Jul 13. [Epub ahead of print] To Reference
Ref 5PGF(2alpha) FP Receptor Contributes to Brain Damage Following Transient Focal Brain Ischemia. Neurotox Res. 2009 Jan;15(1):62-70. Epub 2009 Feb 11. To Reference
Ref 6Prostaglandin subtype-selective and non-selective IOP-lowering comparison in monkeys. J Ocul Pharmacol Ther. 2009 Feb;25(1):1-8. To Reference
Ref 7Bioorg Med Chem. 2009 Jan 15;17(2):576-84. Epub 2008 Dec 6.Discovery of 13-oxa prostaglandin analogs as antiglaucoma agents: synthesis and biological activity. To Reference
Ref 8J Med Chem. 2007 Feb 22;50(4):794-806.Discovery of a potent and selective prostaglandin D2 receptor antagonist, [(3R)-4-(4-chloro-benzyl)-7-fluoro-5-(methylsulfonyl)-1,2,3,4-tetrahydrocyclopenta[b]indol-3-yl]-acetic acid (MK-0524). To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543