| Target
Information |
| Name | Neuraminidase |
| Type of target | Successful target |
| Synonyms | N-acylneuraminate glycohydrolase |
| NANase |
| STNA |
| Sialidase |
| Disease | Influenza, virus not identified [1] |
| Drug(s) | Oseltamivir |  | Approved | Influenza virus infection | [2][3] |
| Zanamivir |  | Approved | Influenza virus infection | [2][3] |
| CS-8958 |  | Phase III | Influenza virus infection | [4] |
| Peramivir |  | Phase III | Influenza virus infection | [4][2] |
| BioChemical Class | Glycosylases |
| EC Number | EC 3.2.1.18 |
| Pathway | Lysosome |
| Other glycan degradation |
| Sphingolipid metabolism |
| UniProt ID | P06818 |
| P29768 |
| PDB Structure | 1DIL; 1DIM; 2SIL; 2SIM; 3SIL. |
| Function | Cleaves the terminal sialic acid (n-acetyl neuraminic acid) from carbohydrate chains in glycoproteins providing free sialic acid which can be used as carbon and energy sources. Sialidases have been suggested to be pathogenic factors in microbial infection. |
| Sequence | MNPNQKIITIGSVSLTIATICFLMQIAILVTTVTLHFKQYECSSPPNNQVMPCEPIIIER
NITEIVYLTNTTIDKEICPKLVEYRNWSKPQCKITGFAPFSKDNSIRLSAGGGIWVTREP
YVSCDPGKCYQFALGQGTTLDNKHSNDTIHDRTPYRTLLMNELGVPFHLGTRQVCIAWSS
SSCHDGKAWLHVCVTGYDKNATASFIYDGRLVDSIGSWSKNILRTQESECVCINGTCTVV
MTDGSASERADTKILFIEEGKIVHISPLSGSAQHVEECSCYPRYPGVRCVCRDNWKGSNR
PVVDINVKDYSIVSSYVCSGLVGDTPRKNDRSSSSYCRNPNNEKGNHGVKGWAFDDGNDV
WMGRTISEESRSGYETFKVIGGWSTPNSKLQINRQVIVDSDNRSGYSGIFSVEGKSCINR
CFYVELIRGREQETRVWWTSNSIVVFCGTSGTYGTGSWPDGADINLMPI
|
| Related US Patent | 6,509,359 |
| 6,518,299 |
| 6,548,476 |
| 6,562,861 |
| 6,593,314 |
| Target Validation | Click to Find Target Validation Information. |
| QSAR Model | Click to Find Target QSAR Model. |
| Inhibitor | (E,E)-1,7-Diphenyl-4,6-heptadien-3-one |  | [5] |
| (E,E)-5-Hydroxy-1,7-diphenyl-4,6-heptadien-3-one |  | [5] |
| (S)-1,7-Diphenyl-6 |  | [5] |
| 2,4-Deoxy-4-Guanidino-5-N-Acetyl-Neuraminic Acid |  | [6] |
| 2-Deoxy-2,3-Dehydro-N-Acetyl-Neuraminic Acid |  | [7] |
| 4- (ACETYLAMINO)-3-HYDROXY-5-NITROBENZOIC ACID |  | [8] |
| 4- (ACETYLAMINO)-5-AMINO-3-HYDROXYBENZOIC ACID |  | [8] |
| 4- (Acetylamino)-3-Amino Benzoic Acid |  | [7] |
| 4- (Acetylamino)-3-Guanidinobenzoic Acid |  | [6] |
| 4-Amino-2-Deoxy-2,3-Dehydro-N-Neuraminic Acid |  | [6] |
| 8-DEOXYGARTANIN |  | [9] |
| A-192558 |  | [10][11][12] |
| A-315675 |  | [10][11][12] |
| APIGENIN |  | [13] |
| Alpha-D-Mannose |  | [7] |
| BCX-1812 |  | [10][11][12] |
| BCX-1827 |  | [10][11][12] |
| BCX-1898 |  | [10][11][12] |
| BCX-1923 |  | [10][11][12] |
| Bcx-1812 |  | [7] |
| Beta-D-Mannose |  | [7] |
| Beta-Sialic Acid |  | [7] |
| CALOPOCARPIN |  | [14] |
| CS-8958 |  | [4] |
| CUDRATRICUSXANTHONE |  | [15] |
| Cudratricusxanthone F |  | [15] |
| Cudraxanthone D |  | [15] |
| Cudraxanthone L |  | [15] |
| Cudraxanthone M |  | [15] |
| Cyclopentane amide derivatives 1 |  | [10][11][12] |
| Cyclopentane amide derivatives 2 |  | [10][11][12] |
| Cyclopentane amide derivatives 3 |  | [10][11][12] |
| Cyclopentane amide derivatives 4 |  | [10][11][12] |
| DANA |  | [10][11][12] |
| DEMETHYLMEDICARPIN |  | [14] |
| ERYSTAGALLIN A |  | [14] |
| Erythribyssin D |  | [14] |
| Erythribyssin L |  | [14] |
| Erythribyssin M |  | [14] |
| Erythribyssin O |  | [14] |
| FANA |  | [10][11][12] |
| Fucose |  | [7] |
| GARCINONE D |  | [9] |
| GARTANIN |  | [9] |
| GOSSYPETIN |  | [13] |
| GS4071 |  | [10][11][12] |
| HERBACETIN |  | [13] |
| ISONEORAUTENOL |  | [14] |
| KAEMPFEROL |  | [13] |
| KATSUMADAIN A |  | [5] |
| Lactose |  | [7] |
| MACLURAXANTHONE |  | [15] |
| MANGIFERIN |  | [15] |
| MANGOSTANIN |  | [9] |
| MANGOSTANOL |  | [9] |
| MANGOSTENONE F |  | [9] |
| MANGOSTENONE G |  | [9] |
| MANGOSTIN |  | [9] |
| NEORAUTENOL |  | [14] |
| O-Sialic Acid |  | [8] |
| OSELTAMIVIR ACID |  | [16] |
| Oseltamivir |  | [2][3] |
| PHASEOLIN |  | [14] |
| PHASEOLLIDIN |  | [14] |
| Peramivir |  | [4][2] |
| RHODIOLININ |  | [13] |
| SMEATHXANTHONE A |  | [9] |
| Zanamivir |  | [2][3] |
| cristacarpin |  | [14] |
| erysubin D |  | [14] |
| erysubin E |  | [14] |
| eryvarin D |  | [14] |
| gamma-mangostin |  | [9] |
| Cross References |
3D Structure
Related Literature
On-Line
Medical Dictionary |
| Ref 1 | New millennium antivirals against pandemic and epidemic influenza: the neuraminidase inhibitors. Antivir Chem Chemother. 2002 Jul;13(4):205-17. To Reference |
| Ref 2 | Current and future antiviral therapy of severe seasonal and avian influenza. Antiviral Res. 2008 Apr;78(1):91-102. Epub 2008 Feb 4. To Reference |
| Ref 3 | Antiviral agents for influenza, hepatitis C and herpesvirus, enterovirus and rhinovirus infections. Med J Aust. 2001 Jul 16;175(2):112-6. To Reference |
| Ref 4 | Developing new antiviral agents for influenza treatment: what does the future hold? Clin Infect Dis. 2009 Jan 1;48 Suppl 1:S3-13. To Reference |
| Ref 5 | J Med Chem. 2010 Jan 28;53(2):778-86.Antiviral potential and molecular insight into neuraminidase inhibiting diarylheptanoids from Alpinia katsumadai. To Reference |
| Ref 6 | Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference |
| Ref 7 | Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference |
| Ref 8 | Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference |
| Ref 9 | Bioorg Med Chem. 2010 Sep 1;18(17):6258-64. Epub 2010 Jul 19.Xanthones with neuraminidase inhibitory activity from the seedcases of Garcinia mangostana. To Reference |
| Ref 10 | Antiviral agents active against influenza A viruses. Nat Rev Drug Discov. 2006 Dec;5(12):1015-25. To Reference |
| Ref 11 | Comparison of the anti-influenza virus activity of cyclopentane derivatives with oseltamivir and zanamivir in vivo. Bioorg Med Chem. 2005 Jun 2;13(12):4071-7. Epub 2005 Apr 25. To Reference |
| Ref 12 | Syntheses and neuraminidase inhibitory activity of multisubstituted cyclopentane amide derivatives. J Med Chem. 2004 Apr 8;47(8):1919-29. To Reference |
| Ref 13 | Bioorg Med Chem. 2009 Oct 1;17(19):6816-23. Epub 2009 Aug 21.Neuraminidase inhibitory activities of flavonols isolated from Rhodiola rosea roots and their in vitro anti-influenza viral activities. To Reference |
| Ref 14 | Bioorg Med Chem. 2010 May 1;18(9):3335-44. Epub 2010 Mar 9.Prenylated pterocarpans as bacterial neuraminidase inhibitors. To Reference |
| Ref 15 | Bioorg Med Chem. 2009 Apr 1;17(7):2744-50. Epub 2009 Feb 26.Characteristic of neuraminidase inhibitory xanthones from Cudrania tricuspidata. To Reference |
| Ref 16 | Antimicrob Agents Chemother. 2008 Oct;52(10):3484-91. Epub 2008 Aug 11.Limited inhibitory effects of oseltamivir and zanamivir on human sialidases. To Reference |